Loading...
HomeMy WebLinkAbout09/18/2023 - Regular Agenda Packet - Bicycle, Pedestrian, and Greenways Advisory Board College Station, TX Meeting Agenda Bicycle, Pedestrian, and Greenways Advisory Board 1101 Texas Ave, College Station, TX 77840 *Internet: www.microsoft.com/microsoft-teams/join-a-meeting Meeting ID: 269 753 645 57 | Passcode: QfdsL9 Phone: +1 979-431-4880 | Phone Conference: 917 612 881# The City Council may or may not attend this meeting. September 18, 2023 3:30 PM Bush 4141 Community Room College Station, TX Page 1 Notice is hereby given that a quorum of the meeting body will be present in the physical location stated above where citizens may also attend in order to view a member(s) participating by videoconference call as allowed by 551.127, Texas Government Code. The City uses a third party vendor to host the virtual portion of the meeting; if virtual access is unavailable, meeting access and participation will be in-person only. 1. Call meeting to order and consider absence requests. 2. Hear Visitors. At this time, the Chairperson will open the floor to citizens wishing to address issues not already scheduled on today's agenda. Each citizen’s presentation will be limited to three minutes in order to allow adequate time for the completion of the agenda items. Comments will be received and city staff may be asked to look into the matter, or the matter may be placed on a future agenda for discussion. A recording may be made of the meeting; please give your name and address for the record. 3. Agenda Items 3.1. Consideration, discussion, and possible action to approve meeting minutes. Attachments: 1. August 14, 2023 3.2. Public Hearing, presentation, discussion, and possible action regarding a recommendation to the Planning and Zoning Commission on the transportation and mobility components within the Northeast Gateway Redevelopment Plan, the associated changes to the Comprehensive Plan Functional Classification & Context Class Map, and the associated maps in the Bicycle, Pedestrian, and Greenways Master Plan including the Proposed Bicycle Facilities Map and the Proposed Pedestrian Facilities Map. Case# CPA2023-000001. (Note: Planning and Zoning Commission action on this item is scheduled for September 21, 2023. Final action on this item is scheduled for the September 28, 2023, City Council Meeting – subject to change.) Sponsors: Matthew Ellis , Jason Schubert Attachments: 1. Northeast Gateway Redevelopment Plan 2. Functional Classification & Context Class Map, from the Comprehensive Plan 3. Proposed Bicycle Facilities Map, from the Bicycle, Pedestrian & Greenways Master Plan 4. Proposed Pedestrian Facilities Map, from the Bicycle, Pedestrian & Greenways Master Plan Page 1 of 206 Bicycle, Pedestrian, and Greenways Advisory Board Page 2 September 18, 2023 3.3. Public Hearing, presentation, discussion, and possible action regarding a recommendation to the Planning and Zoning Commission on the transportation and mobility components within the Wellborn District Plan, the associated changes to the Comprehensive Plan Functional Classification & Context Class Map, and the associated maps in the Bicycle, Pedestrian, and Greenways Master Plan including the Proposed Bicycle Facilities Map and the Proposed Pedestrian Facilities Map. Case# CPA2023-000002. (Note: Planning and Zoning Commission action on this item is scheduled for October 5, 2023. Final action on this item is scheduled for the October 12, 2023, City Council Meeting – subject to change.) Sponsors: Michael Ostrowski, Jason Schubert Attachments: 1. Wellborn District Plan 2. Functional Classification & Context Class Map, from the Comprehensive Plan 3. Proposed Bicycle Facilities Map, from the Bicycle, Pedestrian & Greenways Master Plan 4. Proposed Pedestrian Facilities Map, from the Bicycle, Pedestrian & Greenways Master Plan 3.4. Presentation, discussion, and possible action on the Planning and Development Services Department's Plan of Work. Sponsors: Michael Ostrowski Attachments: 1. PDS Plan of Work FY2023 2. PDS Plan of Work FY2024 3.5. Presentation, discussion, and possible action regarding the development of a potential tactical urbanism program. Sponsors: Carl Ahrens Attachments: 1. Tactical Urbanism Guide - Fayetteville Arkansas 3.6. Presentation and discussion regarding the following items related to biking, walking, and greenways: a. Bicycle, Pedestrian, and Greenways Master Plan – Board Member Madewell b. Public Meetings of Interest c. Capital and Private Project Updates 3.7. Presentation, discussion, and possible action regarding the Bicycle, Pedestrian, and Greenways Advisory Board calendar of upcoming meetings. a. October 16, 2023 ~ Bicycle, Pedestrian and Greenways Advisory Board Meeting at 3:30 p.m. b. November 13, 2023 ~ Bicycle, Pedestrian and Greenways Advisory Board Meeting at 3:30 p.m. 4. Discussion and possible action on future agenda items. A member may inquire about a subject for which notice has not been given. A statement of specific factual information or the recitation of existing policy may be given. Any deliberation shall be limited to a proposal to place the subject on an agenda for a subsequent meeting. 5. Adjourn. Page 2 of 206 Bicycle, Pedestrian, and Greenways Advisory Board Page 3 September 18, 2023 Adjournment into Executive Session may occur in order to consider any item listed on the agenda if a matter is raised that is appropriate for Executive Session discussion. I certify that the above Notice of Meeting was posted on the website and at College Station City Hall, 1101 Texas Avenue, College Station, Texas, on September 13, 2023 at 5:00 p.m. City Secretary This building is wheelchair accessible. Persons with disabilities who plan to attend this meeting and who may need accommodations, auxiliary aids, or services such as interpreters, readers, or large print are asked to contact the City Secretary’s Office at (979) 764-3541, TDD at 1-800-735-2989, or email adaassistance@cstx.gov at least two business days prior to the meeting so that appropriate arrangements can be made. If the City does not receive notification at least two business days prior to the meeting, the City will make a reasonable attempt to provide the necessary accommodations. Penal Code § 30.07. Trespass by License Holder with an Openly Carried Handgun. "Pursuant to Section 30.07, Penal Code (Trespass by License Holder with an Openly Carried Handgun) A Person Licensed under Subchapter H, Chapter 411, Government Code (Handgun Licensing Law), may not enter this Property with a Handgun that is Carried Openly." Codigo Penal § 30.07. Traspasar Portando Armas de Mano al Aire Libre con Licencia. “Conforme a la Seccion 30.07 del codigo penal (traspasar portando armas de mano al aire libre con licencia), personas con licencia bajo del Sub-Capitulo H, Capitulo 411, Codigo de Gobierno (Ley de licencias de arma de mano), no deben entrar a esta propiedad portando arma de mano al aire libre.” Page 3 of 206 MINUTES BICYCLE, PEDESTRIAN, AND GREENWAYS ADVISORY BOARD MEETING August 14, 2023 MEMBERS PRESENT:Chairperson Elizabeth Cunha, Board Members Brad Brimley, Kathy Langlotz, Joy Chmelar, Dennis Jansen, Jake Madewell and Neo Jang STAFF PRESENT:Director of Planning & Development Services Michael Ostrowski, Assistant Director of Planning & Development Services Molly Hitchcock, City Engineer Carol Cotter, Long Range Planning Administrator Alyssa Halle-Schramm, Transportation Planning Coordinator Jason Schubert, Transportation & Mobility Graduate Engineer II Katherine Beaman-Jamael, Transportation & Mobility Staff Planner Carl Ahrens, Senior Long Range Planner Matthew Ellis, Staff Planner Jesse Dimeolo and Staff Assistant II Grecia Fuentes AGENDA ITEM NO. 1: Call to Order and consider absence requests. Chairperson Cunha called the meeting to order at 3:30 p.m. There were no absence requests for consideration. AGENDA ITEM NO. 2: Hear Visitors. There were no visitors who wished to speak. AGENDA ITEM NO. 3: Agenda Items. AGENDA ITEM NO. 3.1: Consideration, discussion, and possible action to approve meeting minutes. Board Member Jansen motioned to approve the meeting minutes from June. Board Member Madewell seconded the motion. Minutes were approved 7-0. AGENDA ITEM NO. 3.2: Presentation, discussion, and possible action regarding election of a Vice Chairperson for the Board. The Board nominated Board Member Langlotz. Page 4 of 206 Board Member Jansen made a motion to approve, Board Member Madewell seconded the motion, motion passed 7-0 AGENDA ITEM NO. 3.3: Presentation, discussion, and possible action regarding an appointment of a Board Member to serve on an advisory committee for the development of a county-wide Comprehensive Safety Action Plan. Transportation Planning Coordinator Jason Schubert presented this item. Coordinator Schubert stated that the Board member appointed would start to meet with the committee later this fall and is anticipated to complete the plan in September of next year. Board Member Langlotz motioned to recommend appointing Board Member Jang, Board Member Jansen seconded the motion, the motion passed 7-0. AGENDA ITEM NO. 3.4: Public hearing, presentation, discussion, and possible action regarding an ordinance amending Appendix A, Unified Development Ordinance, Article 4, “Zoning Districts,” Section 4.2 “Official Zoning Map,” of the Code Ordinances of the City of College Station, Texas by changing the zoning district boundary from PDD Planned Development District to PDD Planned Development District for approximately 33 acres located at 5900 Rock Prairie Road. Case # REZ2023-000062 (Note: Final action of this item will be considered at the August 24, 2023, City Council Meeting – Subject to change). Staff Planner Jesse Dimeolo presented this item. Staff Planner Dimeolo stated the request was to amend a PDD concept plan for a shared use path. The proposed trail connecting to Rock Prairie Road would be moving from the eastside to the westside of the tributary onto the Rock Prairie Baptist Church property side. He added that the applicant and owner have been working closely together with the church property owner and they have a public access easement. He also stated that the trail would be located on the church property and be required to have a public access easement along with the condition that the Midtown MMD be in charge of the construction as well as the maintenance for the path. Board Member Jansen asked why the path alignment seemed different. Mr. Wallace Phillips stated that the original PDD concept plan was made based on the initial zoning and the updated plan shows where it is being built. Board Member Jansen stated that as a person who was opposed to removing the path, this seemed like a great compromise in his opinion. Chairperson Cunha opened the public hearing. Chairperson Cunha closed the public hearing. Page 5 of 206 Board Member Madewell made a motion to recommend approval, Board Member Jansen seconded the motion, the motion passed 7-0. AGENDA ITEM NO. 3.5: Presentation, discussion, and possible action regarding an update on the ongoing Northeast Gateway Redevelopment Plan effort. Senior Planner Matthew Ellis presented this item. Board Member Madewell asked to define a catalyst site. Senior Planner Ellis said that catalyst sites are smaller pieces of the redevelopment area that are the easier to redevelop. Board Member Brimley asked how the interaction with TAMU administration had gone with this plan. Senior Planner Ellis said they held two campus meetings that were not as well attended as they would have liked, but he said it is very hard to get students to attend something like this in the middle of their studies. He mentioned that what those meetings lacked in attendance they certainly made up for it in commentary. He stated that the engagement with administration was not direct because they had a lot of reorganization going on that made it difficult to be in direct contact with them. However, the plan does take into account their master plan efforts in this area. Board Member Jansen asked if it was realistic for Foster Avenue to be extended right in front of Best Buy as well as the Ash Street extension between buildings. Senior Planner Ellis stated that this was a 10-year plan based on what the market shows. He said that having these roads included in the thoroughfare plan sets them up for the redevelopment in the future. Board Member Brimley asked what happens when someone gives up the right-of-way. Senior Planner Ellis said that typically when the right-of-way gets abandoned it goes back to the person who gave the property to the city. He also said that if the property gets sold it does get more complicated. Coordinator Schubert clarified that the Poplar Street right-of-way may not be abandoned but potentially could be used as part of a future grade separation at the intersection of Texas Avenue and University Drive. Board Member Jang inquired about grade separations. Senior Planner Ellis stated that a grade separation is a physical separation in the crossing of traffic movements. In this case, the bicycles and pedestrians would cross the street at a different level than the vehicles. Page 6 of 206 Board Member Brimley inquired about the right-of-way at Walton Drive and Texas Avenue as it seemed to be wasted space. Senior Planner Ellis stated the right-of-way was dedicated by the subdivision plat in 1939 and the action in the plan was looking to provide enhancements to that area. Board Member Jansen asked about the when the plan would be finalized and when they would see it. Senior Planner Ellis stated what was presented is the proposed changes for the planning effort and the final plan is being formatted and would be provided at the next meeting. AGENDA ITEM NO. 3.6: Presentation and discussion regarding an update on the ongoing Wellborn District Plan effort. Long Range Planning Administrator Alyssa Halle-Schramm presented this item. Councilwoman Cunha commented that the proposed raised medians for the Wellborn Road widening project are being led by TxDOT. She said there was a lot of people that were very angry about them. Chairperson Cunha left the meeting at 4:30pm and Vice Chair Langlotz conducted the remainder of the meeting. Board Member Chmelar inquired about why sidewalks were proposed in the plan if the public feedback has not to have them. Long Range Planning Administrator Halle-Schramm stated that some citizens expressed a desire to have sidewalks. The proposed plan combines several planned bike lane and sidewalks along streets to be a planned shared-use path that provides a compromise. Board Member Jang inquired if the shared-use path to be constructed by TxDOT along Wellborn Road was on the east side of the roadway. Long Range Planning Administrator Halle-Schramm confirmed it was on the east side away from the railroad. AGENDA ITEM NO. 3.7: Presentation, discussion, and possible action regarding the Planning and Development Services Plan of Work. Planning & Development Services Director Michael Ostrowski presented this item. Board Member Brimley asked if the shared-use project prioritization list the Board had gone over previously would be implemented into this plan effort. Page 7 of 206 Director Ostrowski said it would be a part of this Plan of Work. Board Member Brimley asked if the information would be provided on the ESRI GIS tool will be available to the public. Senior Planner Ellis said yes, it would be published with the data available. Director Ostrowski stated that the department was taking a more strategic look at transportation and mobility efforts and stated that we have deployed additional resources for it. He said the goal was to identify these projects and make sure we can complete them. AGENDA ITEM NO. 3.8: Presentation, discussion, and possible action regarding an update of the City’s bike map. Staff Planner Carl Ahrens presented this item. Staff Planner Ahrens demonstrated a sample of the City’s updated bike map. He stated that the new map should be done by early September. He mentioned that some of the notable updates on the map were the landmarks like the water tower and Kyle Field to make it easier to identify locations. Board Member Brimley requested that the Board would like to proofread a digital copy before the final copy is printed. Staff Planner Ahrens stated that a digital copy could be shared with the Board before it is finalized. Board Member Chmelar asked if the bike map could be laminated. Staff Planner Ahrens stated he would check with the Public Communications department regarding that possibility. AGENDA ITEM NO. 4: Discussion and possible action on future agenda items. A Bicycle, Pedestrian, and Greenways Advisory Board Member may inquire about a subject for which notice has not been given. A statement of specific factual information or the recitation of existing policy may be given. Any deliberation shall be limited to a proposal to place the subject on an agenda for a subsequent meeting. Chairperson Cunha had requested that the meeting be adjourned on time and discuss the remaining agenda items at the next meeting. Items 3.9, 3.10, and 3.11 were postponed to the next meeting. Vice Chair Langlotz motioned to adjourn meeting. Page 8 of 206 AGENDA ITEM NO. 5: Adjourn The meeting adjourned at 5:00 p.m. APPROVED: ATTEST: ____________________________ ____________________________ Elizabeth Cunha, Chairperson Grecia Fuentes, Board Secretary Page 9 of 206 September 18, 2023 Item No. 3.2. Northeast Gateway Redevelopment Plan Sponsor: Matthew Ellis , Jason Schubert Reviewed By CBC: N/A Agenda Caption: Public Hearing, presentation, discussion, and possible action regarding a recommendation to the Planning and Zoning Commission on the transportation and mobility components within the Northeast Gateway Redevelopment Plan, the associated changes to the Comprehensive Plan Functional Classification & Context Class Map, and the associated maps in the Bicycle, Pedestrian, and Greenways Master Plan including the Proposed Bicycle Facilities Map and the Proposed Pedestrian Facilities Map. Case# CPA2023-000001. (Note: Planning and Zoning Commission action on this item is scheduled for September 21, 2023. Final action on this item is scheduled for the September 28, 2023, City Council Meeting – subject to change.) Relationship to Strategic Goals: • Good Governance • Financial Sustainability • Core Services & Infrastructure • Neighborhood Integrity • Diverse & Growing Economy • Improving Mobility • Sustainable City Recommendation(s): Staff recommends approval. Summary: The Northeast Gateway Redevelopment Plan, an important priority project from the FY23 PDS Plan of Work, has been underway since November 2022. This item comes from Comprehensive Plan Action 2.2, to prioritize and undertake detailed small area plans for priority areas. The planning effort has invited participants to reimagine the area with a new distinct identity that welcomes visitors and residents into the City of College Station. Plan goals include incorporating vertical and horizontal mixed-uses, supporting existing commercial uses, and providing a greater mix of housing options to support the growing population who seek to live, work, and play near Texas A&M University. Staff engaged the community throughout the planning effort by hosting six working group meetings, two meetings on the Texas A&M University campus, two property and business owner meetings, four area-wide meetings, and a virtual area-wide meeting, as well as a virtual engagement website to gather community feedback. Additionally, staff directly engaged with property developers with significant ties in the area and representatives from the Texas Department of Transportation on future mobility projects in the planning area. City staff also coordinated internally to ensure the plan meets the needs of all departments and maintains the City’s excellent services. The Northeast Gateway Redevelopment Plan creates a coordinated strategy for future change and redevelopment along two of the busiest corridors in the city: Texas Avenue and University Drive (FM 60). The plan is divided into two subareas: The Crossing and Eastgate Main. Page 10 of 206 The Crossing is the primary gateway into the City of College of Station and Texas A&M University for visitors entering from Bryan on Texas Avenue and from State Highway 6 along the University Drive (FM 60) hospitality corridor. The Crossing generally includes the area surrounding the intersection, east along University Drive (FM 60) to Tarrow Street, and south along Texas Avenue to Lincoln Avenue. The Crossing anticipates a high level of redevelopment, vertical mixed-use structures, significant increases in housing options and housing stock, an enhanced and expanded multi-modal transportation system, and a denser urban form. Eastgate Main is centered at the intersection of Texas Avenue and New Main Drive/Walton Drive. It contains one of College Station’s historic retail shopping centers, the College Station City Hall and Visitor Center, and is adjacent to the College Hills Estates neighborhood. Eastgate Main is bounded by Foster Avenue, George Bush Drive East, Texas Avenue, and Lincoln Avenue, where it interfaces with The Crossing subarea. Eastgate Main anticipates both vertical and horizontal mixed-use developments that honor the historic commercial structures along Walton Drive while providing additional housing opportunities along Foster Avenue. The relevant transportation and mobility components are found on the following pages: • The Crossing: pages 11 and 26-35 • Eastgate Main: pages 12 and 46-54 • Area-Wide actions: page 59 Staff will present the transportation and mobility components within the Northeast Gateway Redevelopment Plan, the associated changes to the Comprehensive Plan Functional Classification & Context Class Map (Thoroughfare Plan), and the associated maps in the Bicycle, Pedestrian, and Greenways Master Plan including the Proposed Bicycle Facilities Map and the Proposed Pedestrian Facilities Map to the Board for consideration and possible recommendation. Staff will present the Board’s recommendation to the Planning and Zoning Commission at their September 21, 2023 meeting and to the City Council at their September 28, 2023 meeting. Budget & Financial Summary: N/A Attachments: 1. Northeast Gateway Redevelopment Plan 2. Functional Classification & Context Class Map, from the Comprehensive Plan 3. Proposed Bicycle Facilities Map, from the Bicycle, Pedestrian & Greenways Master Plan 4. Proposed Pedestrian Facilities Map, from the Bicycle, Pedestrian & Greenways Master Plan Page 11 of 206 NORTHEAST GATEWAY REDEVELOPMENT PLAN Adopted September 28, 2023 Page 12 of 206 2CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Contents CHAPTER 1 Plan Foundation CHAPTER 2 The Crossing CHAPTER 3 Eastgate Main CHAPTER 4 Plan Implementation APPENDIX A Existing Conditions APPENDIX B Public Engagement Summary APPENDIX C Scenario Modeling 5 13 36 55 63 91 95 Page 13 of 206 3CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Contents MAPS Map 1.1: Northeast Gateway Redevelopment Area Concept Plan Map 2.1: The Crossing Concept Plan Map 2.2: Surface Temperatures from Cooling College Station Map 2.3: Future Street Network Map 2.4: Future Bicycle Network Map 2.5: Future Pedestrian Network Map 3.1: Eastgate Main Concept Plan Map 3.2: Future Street Network Map 3.3: Future Bicycle Network Map 3.4: Future Pedestrian Network Map A.1: Existing Land Use Map A.2: Future Land Use & Character Map A.3: Zoning Map A.4: Code Enforcement Case Density Map A.5: Development Activity Map A.6: Existing Thoroughfare Plan Map A.7: Crash Density Map A.8: Existing Bicycle Plan Map A.9: Existing Pedestrian Plan Map A.10: Bus Routes FIGURES Figure 2.1: Urban Street Rendering Figure 2.2: Parking and Building Placement Examples Figure 2.3: Proposed Urban Street Cross-Section Figure 3.1 Eastgate Park Perspective View Figure 3.2: Eastgate Main Rendering Figure 3.3: Dining Box Perspective View 9 14 21 27 29 30 39 47 49 51 67 68 69 72 74 80 82 84 86 89 15 17 31 43 43 45 Page 14 of 206 4CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Contents TABLES Table 2.1: Suggested Development Standards Table 3.1: Suggested Development Standards Table 4.1: Implementation Matrix Table A.1: Texas A&M University College Station Campus Participation Projections Table A.2: Texas A&M University College Station Campus Student Headcount Table A.3: Code Enforcement Cases, 2012-2022 Table A.4: Development Activity, 2012-2022 Table A.5: Estimated Total Sales, Employees, and Businesses Table A.6: Sales Tax Revenues Table A.7: 2022 Property Values Table A.8 Tax Performance per Acre Table C.1: Base Conditions Comparison Table C.2: Building Type Assumptions Table C.3: Place Type Assumptions Table C.4: Summary Statistics for Scenarios Table C.5: Estimated Floor-Area Ratio Table C.6: 2022 Land and Improvement Values Table C.7: Estimated Property Tax Revenues - $100/SF Scenario Table C.8: Estimated Property Tax Revenues - $125/SF Scenario Table C.9: Estimated Sales Tax Revenues Table C.10: Estimated Total Tax Revenues Per Acre - $100/SF Scenario Table C.11: Estimated Total Tax Revenues Per Acre - $125/ SF Scenario Table C.12: Utility and Transportation Model Outcomes 18 42 60 64 65 71 73 77 78 78 79 96 98 98 99 99 100 101 101 102 102 103 103 Page 15 of 206 5 CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN The Northeast Gateway Redevelopment Plan describes a coordinated strategy for future change and redevelopment within the Northeast Gateway Redevelopment Area identified in Chapter 2, Distinctive Places of the City of College Station Comprehensive Plan. This plan includes a closer look into the existing conditions, trends, and development pressures within the Northeast Gateway Redevelopment Area. This plan covers the time horizon from 2023-2033 and serves as a statement of the community’s intentions for the future. It provides goals and actions on a broad range of topics and provides strategic direction to enable infill and redevelopment and enhance mobility options throughout the planning area while providing opportunities for existing businesses and tenants. In September 2033, on the 10-year anniversary of this plan’s adoption date, the plan is officially retired and serves as a historical reference only. Subsequently, the City of College Station can choose to analyze whether a renewed planning effort is warranted or whether the goals of this plan have been satisfactorily implemented. 1 PLAN FOUNDATION Page 16 of 206 6CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Planning Area While once a predominantly rural and undeveloped area on the edge of the Agricultural and Mechanical College of Texas, the Northeast Gateway Redevelopment Area began to develop in earnest in the 1930s. The construction of Texas A&M University’s Administration Building in 1932 reoriented the primary entrance of the campus from the historic train depot where Wellborn Road sits today to State Highway 6 (now Texas Avenue), creating a formal eastern entrance to campus on New Main Drive that acknowledged the growing primacy of the automobile. The College Hills Estates subdivision was platted in July 1938, just months before community members voted to incorporate College Station as a city in October 1938. The entrance to the neighborhood was set opposite the new entrance to Texas A&M University, mimicking the curved highway entrance and exit pattern from across the street. The College Hills Estates neighborhood also employed the curvilinear streets and dedicated parkland practices seen elsewhere in the area during that era, while adding an auto-oriented shopping village at the New Main Drive/Walton Drive and State Highway 6 intersection (now Texas Avenue). The College Hills Estates neighborhood would be the first, but not the only, development to contribute to the Eastgate area, so named for the adjacent eastern gate into the Agricultural and Mechanical College of Texas. Another historic structure in the area at 903 Texas Avenue is documented in A Guide to Historic Brazos County. This one-story, free-standing brick building with art deco influences was constructed between 1941 and 1942. 1939 map of College Station Page 17 of 206 7CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN 1979 aerial photograph of City Hall The Northeast Gateway Redevelopment Area experienced continued growth and development through the 1960s. During this period, the City of College Station established an administrative complex along Texas Avenue, including a city hall and fire station, built between 1969 and 1983. The majority of University Drive (FM 60) – previously called Sulphur Springs Road – was constructed in 1968 when it was extended east from its previous terminus at Texas Avenue to connect to the rerouted State Highway 6 – now the Earl Rudder Freeway. With this new link to the highway, the University Drive (FM 60) and Texas Avenue corridors would gradually fill in with commercial development through the 1990s. Since the 1990s, most development has been infill since much of the area had generally been developed by this point, leaving few opportunities for new, large-scale developments. Following the success of high-rise developments in Northgate after 2012, more interest and pressures for redevelopment have been seen in this area. The most significant development project was Northpoint Crossing, developed in 2014 on the northwestern corner of Texas Avenue and University Drive (FM 60). Embassy Suites also developed a new hotel along Jane Street in 2016. This structure is taller than other commercial structures around it and has reduced setbacks similar to what this plan proposes for the whole planning area. Most recently, the City of College Station developed a new City Hall along the same block as the prior site and rehabilitated the former fire station to house a visitor’s center and Visit College Station. 1940 aerial of College Station Page 18 of 206 8CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Plan Creation RELATIONSHIP TO COMPREHENSIVE PLAN The Comprehensive Plan indicates that “this area includes a number of underperforming land uses that…are poised for redevelopment,” suggesting that the planning effort should complement the nearby hospitality corridor, the Eastgate area, and the Texas A&M University Campus Master Plan while bringing aspects of an urban character to this portion of the City. Additionally, Comprehensive Plan Action 2.2 directs staff to prioritize and undertake detailed plans for priority neighborhoods, districts, corridors, or redevelopment areas. During the 2021 Comprehensive Plan update, the Northeast Gateway Redevelopment Area was identified as a priority planning area. This is the first small area plan effort to be adopted under the 2021 City of College Station Comprehensive Plan. PLANNING PROCESS The beginning phases of the planning process included community visioning and brainstorming for the future of the planning area. During the Phase 1 meetings, participants were asked to help envision a new identity for the district, potential changes that could benefit the area, and strengths of the area that should be maintained. City staff grouped these comments into broader categories that helped inform the second phase of public engagement. The Phase 2 meetings focused on the categories from Phase 1, crafting the broad themes into goals and beginning to think about actions that would help implement them. Meeting participants helped City staff write the final goals for the plan and brainstormed actions to implement the goals of the plan. City staff wrapped the first two phases of the planning effort by conducting workshops with the Planning and Zoning Commission and City Council to explain the process and public input received through Phase 2 and ask for input and direction. The middle phases of the planning effort focused on selecting a preferred scenario from three options that a consultant team from Asakura Robinson developed with City staff. The Phase 3 meetings offered individuals the opportunity to provide input on the scenarios and help identify additional actions that should be pursued during the plan. “Asakura Robinson and City staff then collated the preferred scenario and public feedback into Map 1.1 Northeast Gateway Redevelopment Area Concept Plan. Staff completed the middle phases of the planning effort with a final area-wide meeting and an online survey. The final stage of this planning effort included meetings with the Bicycle, Pedestrian, and Greenways Advisory Board, the Planning and Zoning Commission, and City Council. The final plan was presented to the board and commission for their recommendation. The plan, along with the recommendations from the board and commission, was forwarded to the City Council for final adoption. After the plan was adopted by the City Council, staff began implementation of the actions in the plan. Implementation will occur over the planning horizon through City investments in infrastructure and programs, changes in regulations and policies that support a more urban character, and private development decisions. PHASE 1BRANDING/IDENTITY PHASE 2GOAL SETTING WORKSHOPS WITH APPOINTED& ELECTEDOFFICIALS PHASE 3ACTIONIDENTIFICATION PLAN FINALIZATIONAND FINAL PUBLICENGAGEMENT PLAN ADOPTION BY APPOINTED& ELECTEDOFFICIALS IMPLEMENTATION Page 19 of 206 SOURCE: ASAKURA ROBINSON TE X A S A V E TE X A S A V EUNIVERSITY DRGEORGE BUSH DR ENEW MAIN DRPOPLAR ST LINCOLN AVE WALTON DRFRANCIS DRNI M I T Z S T F O S T E R A V E JA N E S T COONER ST LIVE OAK ST. ASH ST GILCHRIST AVEEI S E N H O W E R S T Northeast Gateway Redeveloment Area Concept Plan MAP 1.1 FUTURE LAND USE URBAN CENTER NEIGHBORHOOD CENTER MIXED RESIDENTIAL INSTITUTIONAL/PUBLIC PARKS & GREENWAYS CATALYST SITE PRIMARY ARRIVAL GATEWAY KEY INTERSECTION TEXAS A&M CAMPUS VISTA BILLIE MADELEY PARK CONNECTION PRIORITY PED/BIKE CONNECTION KEY PUBLIC SPACE ACTIVATION Page 20 of 206 10CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN PROJECT TEAMS Every planning effort requires coordination between stakeholders, staff, and appointed and elected officials. This planning effort engaged Asakura Robinson as an urban design consultancy, City staff, a working group of volunteers, the Planning and Zoning Commission and City Council, and the general public to build the plan’s vision, goals, and actions. Members of the various project teams are identified in the Acknowledgments at the end of the plan. ASAKURA ROBINSON Asakura Robinson is a planning, urban design, and landscape architecture practice headquartered in Austin, Texas. They strive to bring comprehensive, equitable, sustainable, and implementable solutions to cities of all sizes. They collaborated with City staff on the scenario planning activities, concept plan, graphics, and plan content. STAFF RESOURCE TEAM The Staff Resource Team consisted of representatives from each department within the City to shepherd the plan and offer internal coordination opportunities. The Staff Resource Team met after each phase of the project to talk through any new information or decisions and confirm the roadmap for the next phase of the project. PLANNING & DEVELOPMENT SERVICES RESOURCE TEAM The Planning & Development Services Resource Team was comprised of staff from each of the divisions within the Planning & Development Services department to provide periodic updates and prepare for meetings with the Staff Resource Team and Working Group. This team met every other month in addition to bi-weekly check-ins on progress. WORKING GROUP The Working Group was a group of individuals that volunteered to help City staff determine the direction of the plan and provide more focused input throughout its creation. The group was comprised of property and business owners and residents within or around the planning area. Participants learned about small area planning, offered direction on specific components of the plan, and served as ambassadors for the project in their community circles. Page 21 of 206 11CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Plan Goals & Structure The Northeast Gateway Redevelopment Plan is of interest to community residents, investors, developers, business owners, and others interested in how the area will evolve over the next 10 years. The plan is divided into chapters representing each plan subarea: The Crossing and Eastgate Main. Each chapter contains goals, corresponding actions, narrative descriptions, and maps that provide direction for how the area should redevelop over time. CHAPTER 1: PLAN FOUNDATION The first chapter details the history of the area and provides an overview of the planning process and public participation opportunities. CHAPTER 2: THE CROSSING The Crossing is identified as the portion of the planning area that is north of Lincoln Avenue. This area is mostly composed of the Urban Center and Mixed Residential future land use designations, anticipating a higher level of redevelopment than Eastgate Main. The Crossing anticipates significant increases in housing options and housing stock, an enhanced and expanded multi-modal system, and a denser urban form. CHAPTER 3: EASTGATE MAIN Eastgate Main is the portion of the planning area that is south of Lincoln Avenue. This area is composed of the Neighborhood Center future land use designation, which anticipates both vertical and horizontal mixed- use developments. Eastgate Main best supports horizontal mixed-use development that honors the historic commercial structures along Walton Drive while providing additional housing opportunities along Foster Avenue. THE THREE GOALS FOR THE CROSSING ARE: 1. Build a vibrant and distinct identity for the crossing that embraces an attractive urban form with versatile public spaces. 2. Ensure the availability of residential and commercial opportunities throughout the district. 3. Provide a safe and connected multi-modal mobility system designed to support all modes traveling to, from, and throughout the district. Page 22 of 206 12CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN CHAPTER 4: PLAN IMPLEMENTATION The final chapter establishes accountability for the execution of this plan and guides the necessary processes that come with plan implementation. In addition to detailing several area-wide actions, it collates the actions from the previous chapters and identifies implementation priorities and strategies. THE THREE GOALS FOR EASTGATE MAIN ARE: 1. Enhance the existing historic identity of eastgate main by enabling and incentivizing appropriate and contextual infill, redevelopment, and revitalization. 2. Support the interests of current residents and businesses while redevelopment occurs. 3. Strengthen the existing multi-modal mobility system to support a diversity of modes of travel. Page 23 of 206 13CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN The Crossing is one of the subareas of the Northeast Gateway Redevelopment Area. The dividing line for the subareas is Lincoln Avenue; The Crossing is the northern half of the planning area. The Crossing is oriented to the intersection of Texas Avenue and University Drive (FM 60). It includes areas designated as Urban Center and Mixed Residential on the Comprehensive Plan Future Land Use & Character Map. Currently, The Crossing is home to a variety of automobile-oriented retail and service uses, big-box shopping centers, hotel lodging, and owner-occupied and student-oriented housing. Its prominent location at a pedestrian entrance and vista to Texas A&M University makes The Crossing a primary gateway to the City of College of Station and Texas A&M University for visitors entering from Bryan on Texas Avenue and from State Highway 6 along the University Drive (FM 60) hospitality corridor.  The Crossing’s commercial setting and orientation to two major arterials have resulted in an auto-centric public realm that is poised for infill and redevelopment as aging and underperforming commercial structures depreciate. Although much of the area has been divided into smaller lots, large parcels containing big-box shopping centers and excess parking areas can provide catalytic sites for infill or redevelopment and improved street connectivity.  2 THE CROSSING Page 24 of 206 SOURCE: ASAKURA ROBINSON The Crossing Concept Plan FUTURE LAND USE URBAN CENTER MIXED RESIDENTIAL INSTITUTIONAL/PUBLIC CATALYST SITE PRIMARY ARRIVAL GATEWAY KEY INTERSECTION TEXAS A&M CAMPUS VISTA BILLIE MADELEY PARK CONNECTION PRIORITY PED/BIKE CONNECTION KEY PUBLIC SPACE ACTIVATION TE X A S A V E TE X A S A V EUNIVERSITY DRGEORGE BUSH DR ENEW MAIN DRPOPLAR ST LINCOLN AVE WALTON DRFRANCIS DRNI M I T Z S T EI S E N H O W E R S T F O S T E R A V E JA N E S T COONER STLIVE OAK ST. ASH STGILCHRIST AVEM AP 2.1 Concept Plan Map 2.1: The Crossing Concept Plan highlights key design elements and opportunities addressed further in this chapter that can be implemented through future redevelopment or public investment. Page 25 of 206 15CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN CHARACTER & URBAN FORM Building on the future land use categories described in the Comprehensive Plan, the Concept Plan prioritizes orienting development within the Urban Center areas towards Texas Avenue and University Drive (FM 60). Though the Comprehensive Plan anticipates an average of five (5) stories and mixed-use development throughout the Urban Center future land use, taller buildings at the intersection of and along the Texas Avenue and University Drive (FM 60) corridors would support a higher level of activity and help frame one of the primary gateways to the city. Infill and redevelopment along an improved Live Oak Street or the extension of Foster Avenue also provide space for a new mix of uses. The example in Figure 2.1 Urban Street Rendering exhibits a new development pattern that should be sought in The Crossing. Mixed Residential areas along Cooner Street and southeast of the Live Oak Street/Eisenhower Street intersection support a greater diversity of housing opportunities and help transition from Urban Center land uses to adjoining single-family neighborhoods.  GATEWAYS & KEY INTERSECTIONS The intersection of Texas Avenue and University Drive (FM 60) is the pinnacle intersection within The Crossing. This intersection is one of six Primary Arrival Gateways into the city, which the Comprehensive Plan describes as “locations where the most substantial enhancements should be installed. [Enhancements] may include significant monument signage, substantial areas of landscaping and tree planting, fountains, lighted icons, and large-scale art.” Texas A&M University’s 2017 Campus Master Plan also recognizes the importance of this gateway, identifying new improvements for the southwestern corner of the intersection including a new monument sign. Other key intersections include the intersection of University Drive (FM 60) at Tarrow Street and the signalized entrance to the Lone Star Pavilion shopping center from Texas Avenue.  Figure 2.1: Urban Street Rendering Page 26 of 206 16CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN CATALYST SITES The Concept Plan highlights four catalyst sites within The Crossing:  While infill or redevelopment of these sites will be driven by the private sector, these sites represent development opportunities with fewer parcel assembly constraints and locations for important mobility infrastructure or new public spaces.  Distinctive Places  GOAL: Build a vibrant and distinct identity for The Crossing that embraces an attractive urban form with versatile public spaces. As one of the subareas of the Northeast Gateway Redevelopment Area and a primary gateway to the Texas A&M University campus, The Crossing provides a strong opportunity for urban development types and public spaces that are currently only available in Northgate area and Century Square. Creating a distinct urban space that caters to a broader cross-section of the College Station community will require quality development and design stemming from public and private sector cooperation.  BUILDING FORM & USE Future development within The Crossing’s Urban Center areas will contribute to the creation of a vibrant, walkable district. The form, siting, and uses of buildings play important roles in creating a comfortable and inviting pedestrian realm by providing easy and convenient access close to major pedestrian routes and activating streets with ground-floor uses that generate foot traffic and visual interest. ∙The University Plaza shopping center at University Drive (FM 60) and Tarrow Street;  ∙The block containing the Bank of America building that is bounded by Texas Avenue, Cooner Street, Jane Street, and University Drive (FM 60);  ∙The restaurant and hotel area on both sides of Live Oak Street; and  ∙The Lone Star Pavilion shopping center and outparcels bounded by Texas Avenue, Eisenhower St. and Lincoln Ave.  Live Oak Street Example branding for The Crossing Page 27 of 206 17CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Figure 2.2: Parking and Building Placement Examples shows possible siting and location combinations for various vertical mixed-use structures. A mix of uses is encouraged in both vertical mixed-use buildings and horizontal mixed-use developments, where uses can be in separate buildings that are connected through site design. Mixed-use and multi-family housing development will help residents live close to major employers and amenities and provide customers for retail and service providers. Locating buildings close to the street with consistent massing and setbacks creates visual consistency that provides a sense of enclosure for drivers. Including several vertical elements, such as street trees or pedestrian spaces, in a driver’s field of vision has a traffic-calming effect, creating a safer and more welcoming space for pedestrians and cyclists.1 Figure 2.2: Parking and Building Placement Examples Page 28 of 206 18CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Table 2.1 Suggested Development Standards Area Urban Center Mixed Residential Maximum Height 5 stories / 60-ft (above 5 stories with density/height bonus)35-ft Average Number of Stories 4 2 Vertical Mixed-Use Encouraged Not permitted. Minimum Front Setback 20-ft minimum setback from the curb.5-ft minimum setback. Maximum Front Setback If no parking is provided: maximum 15-ft. If a one-way drive aisle and single-loaded 45-degree angled parking are provided: maximum 50-ft. If a two-way drive aisle and double-loaded perpendicular parking is provided in front of the structure: maximum 100-ft. 25-ft maximum setback. Setbacks below 15-ft encouraged. Block Length Not to exceed 660-ft per face. Smaller block sizes or pedestrian passages between 300-400-ft are encouraged to promote a walkable grid network. Not to exceed 660-ft. Front Parking Discouraged. Not permitted along Foster Avenue. For other areas, a single row of parking is permitted when separated from the right-of-way by a sidewalk and a landscape buffer of 6-ft with street trees. Permitted. Side/Rear Parking Permitted.Permitted. Building Orientation The primary entrance should be facing the street or intersection (if located at an intersection). The primary entrance should be facing the street or intersection (if located at an intersection). Sidewalks Minimum 8-ft. For high-traffic areas, 12-ft and canopy overhangs to provide shade are recommended.Minimum 6-ft. Table 2.1 Suggested Development Standards contains example development standards to implement the vision of the plan. These development standards should be used to assist in future ordinance amendments. Century Square is a mixed- use development west of the planning area. 100 Park provides needed housing units next to Texas A&M University and customers for the surrounding commercial uses. Page 29 of 206 19CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Within Mixed Residential areas, residential redevelopment, including through the MH Middle Housing zoning district, is anticipated to provide a mix of housing types, including single-family homes, duplexes, townhouses, live-work units, courtyard houses, and multiplexes. In combination with the commercial uses anticipated in the Urban Center areas, the mix of different housing types embodied by the MH Middle Housing zoning district will enable a new generation of faculty, staff, and students of Texas A&M University to live, work, and recreate next to the university. These new housing opportunities are also anticipated to reduce the development pressures in the surrounding single-family residential areas.  PUBLIC SPACE Parks, plazas, and open spaces provide opportunities for residents, workers, and visitors to relax and gather. Though parks and open spaces such as Lions Park, Billie Madeley Park, and the Polo Fields are located just outside of The Crossing, no public space exists within The Crossing. Creating new public spaces and improving connections to the existing public spaces just beyond the planning area are priorities. Three key public spaces are proposed with the future redevelopment of The Crossing: a central green or plaza within the Lone Star Pavilion catalyst site near future extensions of Foster Avenue and Ash Street; a green or plaza within the University Plaza catalyst site with potential stormwater management features to help mitigate issues within the area; and a shared-use path connection from Cooner Street and the University Plaza area to Billie Madeley Park, which is currently only accessible through the City of Bryan. The design, function, and connectivity of these spaces should be determined in conjunction with the property owner or developer and the community to identify desired amenities and features. As The Crossing’s redevelopment will provide new housing opportunities for residents and families, the design of these spaces should also consider the needs of multigenerational households and children. In addition to providing recreational space, these spaces can be designed to provide on-site stormwater management and detention, supplementing capacity at existing stormwater management facilities. In contrast to conventional detention basins, low-impact development techniques can allow stormwater to infiltrate through the ground while minimizing the footprint dedicated to standalone space. Water features can also cool the air and provide a calming effect with white noise. Siting these spaces near existing stormwater facilities such as the detention basin at University Plaza or within the low-lying area of Lone Star Pavilion’s parking lot could minimize disruptions and enhance their effectiveness. Because there is very little public property within The Crossing, the City will need to collaborate with private property owners to locate, design, and manage public space. Public space can be either publicly owned, if purchased by or dedicated to the City, or privately owned by the developer, such as The Green at Century Square. The mechanisms to create public space vary but can include parkland dedication, land dedication for public use in return for incentives such as a height bonus, public-private partnerships that include a mix of public funds or in- kind management or maintenance, and public access easements or agreements. Example of new housing construction in the Mixed Residential area on Cooner Street. Existing parking lot sign at the Lone Star Pavilion shopping center Page 30 of 206 20CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN ARTS, CULTURE, & PROGRAMMING Cultural institutions play an important role in creating a district’s identity and activating public spaces through arts and programming. Nearby Century Square includes a mix of sculptures and murals that pay homage to Texas A&M University’s culture and traditions. Century Square’s management also hosts events on The Green, with its Front Porch live music series, Century Square Cinema movie screenings, and monthly Shopping on the Square vendor markets. Except for religious institutions and the Benjamin Knox Gallery, there are few existing spaces for culture and art within The Crossing, and a lack of public space prevents programming opportunities. Future public space within The Crossing can create opportunities for partnerships with arts institutions such as the Arts Council of Brazos Valley, the Texas A&M University School of Performance, Visualization & Fine Arts, and the Texas A&M University Academy for the Visual and Performing Arts. New development could support the arts, especially if site-specific art installations or contributions to art funds are included as a criterion for bonus heights. The hospitality industry and arts are closely aligned, and hotel occupancy tax revenues within the area can support Visit College Station and investment in the arts. Besides direct investment in the arts, The Crossing can support the growth of cultural institutions by providing affordable spaces for artists and artisans. Vacant buildings and storefronts can be adapted and reused as makerspaces, creating new activity within The Crossing and increasing occupancy of otherwise underutilized spaces. URBAN FORESTRY & HEAT ISLAND MITIGATION While hot summers are an unavoidable fact of life in Central Texas, the additional impacts of heat can be especially pronounced in heavily paved urban areas that absorb and retain heat through pavement and building materials. According to the Environmental Protection Agency (EPA), heat islands are “urbanized areas that experience higher temperatures than outlying areas.” Heat has a significant negative impact on pedestrian and cyclist comfort, with elevated surface temperatures in denser areas reducing comfort when compared to greener, more natural landscapes with trees and shade. The Cooling College Station plan addresses urban heat islands, visualized estimated surface temperatures across College Station, and outlined a five-year tree planting plan for public parks, rights-of-way, and other City properties. Map 2.2: Surface Temperatures from Cooling College Station shows the relative urban heat in the planning area. Planning for urban tree canopy with future redevelopment in The Crossing can help mitigate the heat island effect present within this area: the surface temperature analysis from Cooling College Station highlights increased surface temperatures within The Crossing when compared to neighboring areas such as Eastgate Main and Century Square. Planting trees around buildings, in parking lots, and public spaces and rights-of-way is one of the most effective techniques to reduce heat islands, as the greenery provides shade and evapotranspiration that lowers surface and air temperatures. Page 31 of 206 UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEI S E N H O W E R S T EI S E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T S O U T H C O L L E G E A V E S O U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEI S E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T S O U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRSurface Temperatures from Cooling College Station DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS MID HIGHLOW M AP 2.2 Page 32 of 206 22CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Strong Neighborhoods & Prosperous Economy GOAL: Ensure the availability of residential and commercial opportunities throughout the district. As The Crossing redevelops, the availability of residential and commercial opportunities will expand. More housing options and choices will become available and vertical mixed-use structures will bring new commercial prospects that have not been available in College Station. However, this redevelopment should be pursued in a phased approach so as not to displace residential and commercial tenants due to a lack of opportunity or skyrocketing rental prices. HOUSING FOR DIVERSE RESIDENTS Reflecting the community’s existing and future housing needs and demographic characteristics, future development and redevelopment of different housing types will expand housing opportunities for all residents of the City of College Station, including faculty, staff, and students of Texas A&M University. While detached single-family homes have historically been the base of College Station’s housing stock, the MH Middle Housing zoning district can provide more for-sale and for-rent opportunities for households and families seeking a walkable lifestyle near employment opportunities and amenities, particularly as rising land values raise the costs of single-family home ownership. Even as appraised land values increase within Brazos County, denser housing types can remain more affordable over time because they consume less land and can spread property value and tax costs across a greater number of households, reducing the burden on individual homeowners or renters. Additionally, by enabling the MH Middle Housing zoning district and incentivizing higher-density housing in this redevelopment area, development pressures can be concentrated here and outside of established single-family neighborhoods. Furthermore, the MH Middle Housing zoning district provides greater flexibility and serves as a transitionary buffer between more intense urban uses and established single-family zoning districts. Encouraging amenities such as green space and childcare close to housing opportunities can also make The Crossing more attractive to families. Page 33 of 206 23CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN MIXED-USE DEVELOPMENT TYPES Creating an urban center within The Crossing requires compact, mixed-use development to create activity and pedestrian traffic. Mixing residential and economic/employment-generating uses in a compact development form provides housing in an amenity-rich area, generates foot traffic for retail and service uses, and creates attractive locations for office workers and employers. Mixed-use development can take the form of vertical mixed-use, where a single building contains commercial uses on the ground floor and/ or upper stories as well as residential uses above, or horizontal mixed-use, which combines commercial and residential uses within a walkable, compact site. Vertical mixed-use developments should provide a variety of retail and service space sizes and configurations on their first floors to support a mix of users and needs. Use requirements should be flexible and allow complementary sectors to cluster in the area, such as wellness and lifestyle-oriented businesses like yoga studios and juice bars, or makerspaces and professional offices. Major challenges to the successful development of vertical mixed-use buildings can include the availability of financing for the developer and commercial real estate market demand. Vertical mixed-use development is more complex than horizontal mixed-use development due to building code requirements and the mix of revenues and management needs. Additionally, a comment staff received repeatedly throughout the planning process was how perceptions of access to retail spaces can impact customer traffic. Developments that do not have clear access points, including front-row parking, have had limited success. ECONOMIC DEVELOPMENT Wherever possible, redevelopment within The Crossing should support the retention of existing businesses. While mixed-use development may seem like a major change to the big-box format of many retailers and anchors, many national retailers have successfully opened stores in urban and mixed-use developments, as evidenced by the Buffalo Heights H-E-B. Since a variety of big-box retailers are present within this area, development regulations should avoid setting overly restrictive maximum limits for allowable gross floor area for ground-floor retail establishments. Maintaining flexibility for retailers and commercial tenants will be critical as this sector continues to adapt to the effects of the COVID-19 pandemic, the rise of online retail, and the growing need for backroom spaces for online order fulfillment and pickup. H-E-B store in Buffalo Heights mixed-use development in Houston. Page 34 of 206 24CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN As The Crossing continues to redevelop, small-scale commercial and office uses may be able to take root in older and lower-rent spaces, providing space for this sector. Large spaces such as the former Albertson’s store at the University Plaza shopping center could accommodate a larger tenant or could be divided to permit small-scale pop-up shops that allow small businesses to scale and activate vacant spaces. Pop-ups typically include short-term agreements rather than long-term leases, providing flexibility for the property owner. Makerspaces and small-scale manufacturers, often called micro-industrial uses, can also catalyze economic development and adaptive reuse within The Crossing. As opposed to the popular conception of large factories and heavy manufacturing as massive, loud, and polluting entities, small-scale manufacturing utilizes recent technologies that are clean, quiet, and can fit into smaller spaces. Where the retail market is unable to support full occupancy of retail spaces, these makers can occupy difficult-to-lease or less desirable retail spaces. The presence of a small storefront can provide opportunities to market directly to local customers while the rear spaces are used for production. Finally, the proximity of The Crossing to Texas A&M University can also support collaborations with students, staff, and faculty from the University. INFILL & REDEVELOPMENT The Northeast Gateway Redevelopment Area contains retail and office buildings in a variety of sizes and conditions, from larger big-box retail spaces to smaller offices. Within The Crossing, these spaces tend to be larger as part of a shopping center or strip development. However, a variety of spaces within The Crossing are currently vacant, including ground-floor retail spaces in the Northpoint Crossing development and the former Albertson’s store at the University Plaza shopping center. As market conditions begin to encourage infill and redevelopment within these areas, providing flexibility for the reuse of vacant spaces will encourage continued economic development and placemaking opportunities within the area. Key opportunities within The Crossing could include permitting spaces for small business pop-ups, makers, and small-scale manufacturers. The recent elimination of parking minimums within redevelopment areas could provide flexibility for users seeking to occupy existing spaces and remove a barrier to redeveloping vacant or underutilized parking areas or developing new pad sites. This screen-printing business is an example of a small-scale manufacturing enterprise. Triangle Pop-Up Market in Raleigh, NC. Page 35 of 206 25CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Redevelopment encourages the continued longevity and adaptation of existing businesses and residents while creating the space and amenities to attract and house new businesses and residents. Strategies to reconnect the street grid and create new spaces for businesses and residents can be completed incrementally over time. Achieving the plan’s vision of redevelopment will require smaller projects and site activations, with a phased approach ensuring the continued operation of existing tenants until they are ready for potential change. When redevelopment sites contain underutilized spaces such as vacant buildings or parking lots, redeveloping these areas provides options for businesses to temporarily relocate and remain in the area during construction and development, while reducing financial risk. However, the City should coordinate with business and economic development entities such as the Brazos Valley Economic Development Corporation to develop strategies that minimize construction disruptions and displacement. Construction disruption assistance could include technical assistance or financial assistance through short-term loans or grant programs for lost revenues due to redevelopment and construction. INCENTIVES FOR QUALITY DEVELOPMENT Creating the desired community character and form within The Crossing area will be primarily driven by the private sector through infill and redevelopment. Accordingly, aligning development regulations and incentives to encourage the provision of high-quality urban design and public spaces will be a critical implementation strategy. While Texas enabling authority prohibits the outright requirement of public benefits like affordable housing in new development, cities can use financial or regulatory incentives to encourage the provision of public benefits in new development. Common regulatory incentives include height and density bonuses, which allow developers to go above a standard height or density limit in return for providing benefits such as affordable housing, public space, pedestrian and bicycle amenities, and more. This type of market-driven incentive can achieve both public and private goals in new development. Bonuses for providing affordable housing typically require setting aside a certain percentage of on-site residential units as affordable, or contributing to an affordable housing fund, depending on the community’s definitions and policies. Public spaces and facilities that exceed standard design requirements in site development plans or subdivisions standards can also qualify for bonuses, often in proportion to the amount of land dedicated. Setting base height or density limits, thresholds for bonuses, and administrative procedures should be coordinated and prioritized as strategic actions stemming from this planning effort. As The Crossing is intended to be the site of the most intense development within the planning area, the City should incorporate regulatory incentives such as height bonuses in future zoning ordinance updates to encourage high-quality and dense development within this area. The City should develop a density bonus system to encourage public benefits as a component of development and achieve other goals in this plan, including the dedication of space for public use or the construction of priority mobility connections such as bicycle and pedestrian facilities. The incentive structure should ensure that the increases in height or developable area are proportional to the public benefits received. Page 36 of 206 26CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Integrated Mobility GOAL: Provide a safe and connected multi-modal mobility system designed to support all modes traveling to, from, and throughout the district. Infill and redevelopment will bring more people to The Crossing to live, shop, or recreate. Enhancements are needed to the mobility system to handle the additional trips within the district. These additional paths and improvements should be carefully planned to maximize impact and safety for all users. FUTURE STREET NETWORK Map 2.3: Future Street Network focuses on building a robust, urban street grid and providing alternatives to Texas Avenue and University Drive (FM 60) with high-quality facilities for pedestrians and cyclists. While shared-use paths and sidewalks exist along sections of these two arterials, they may not be preferred routes for pedestrians and cyclists due to a lack of adequately separated facilities, gaps in the existing network, excessive noise and heat, and distances to storefronts. Connections prioritized for future improvement within The Crossing are the extension of Foster Avenue from Lincoln Avenue to Live Oak Street, the extension of Ash Street from its existing terminus to the signal at Texas Avenue, and the bicycle facility along Ash Street and Nimitz Street between the Ash Street/ Eisenhower Street intersection and Nimitz Street’s terminus at Cooner Street. These will provide improved connectivity to existing neighborhoods, create an alternative bicycle and pedestrian crossing at University Drive (FM 60), and support development within important catalyst sites. Additionally, one of the actions of the plan suggests improvements to Live Oak Street, including eliminating the existing offset at Eisenhower Street and providing improved bicycle and pedestrian facilities to encourage redevelopment. In addition to these improvements between University Drive (FM 60) and Lincoln Avenue, an important bicycle and pedestrian connection could be made between the existing right-of-way of Cooner Street and the University Plaza shopping center to provide additional access and complete a parallel bicycle and pedestrian network to University Drive (FM 60) through the district. Although existing grades and stormwater facilities currently prevent a direct connection between Cooner Street and Chimney Hill Drive, future redevelopment of the University Plaza shopping center should formalize the bicycle and pedestrian connection between Cooner Street and Tarrow Street/Arguello Drive. Page 37 of 206 SOURCE: ASAKURA ROBINSON TE X A S A V E T E X A S A V EUNIVERSITY DRPOPLAR ST LINCOLN AVENI M I T Z S T EI S E N H O W E R S T F O S T E R A V E JA N E S T COONER ST LIVE OAK ST ASH ST 6 LANE MAJOR ARTERIAL 4 LANE MAJOR ARTERIAL 4 LANE MINOR ARTERIAL 2 LANE MAJOR COLLECTOR PROPOSED 2 LANE MAJOR COLLECTOR 2 LANE MINOR COLLECTOR PROPOSED 2 LANE MINOR COLLECTOR RECOMMENDED STREET EXTENSION RECOMMENDED STREET CLOSURE Future Street Network MAP 2.3 Page 38 of 206 28CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN HIGH-COMFORT BICYCLE & PEDESTRIAN FACILITIES A walkable, bikeable, and vibrant urban center requires high-quality and high-comfort pedestrian and bicycle facilities. Development of pedestrian and bicycle facilities must emphasize comfort, recognizing the impacts of vehicular traffic speeds, noise, heat, and slope that can reduce perceptions of safety and create stress for users.2 High-comfort facilities serve users of all ages and abilities. Strategies to improve comfort can include lowering vehicular speeds, providing additional separation from vehicular traffic through horizontal or vertical separation or barriers, providing street trees and shade, and providing facilities that are sized appropriately to allow users to pass or maneuver with ease. Many of these strategies can be implemented through street section design guidance in the Bryan/College Station Unified Design Guidelines, as well as careful coordination with Texas Department of Transportation (TxDOT) design guidelines. As design standards based on functional classifications typically prioritize vehicle movement over local urban design context and pedestrian and bicycle comfort, future updates should respond to specific local contexts and anticipate where exceptions are needed. Establishing additional pedestrian crossings, such as a crosswalk at the Lone Star Pavilion signalized intersection, can reduce the length of pedestrian trips. Several changes are proposed to the Bicycle Plan within the Bicycle, Pedestrian, and Greenways Master Plan, as reflected in Map 2.4: Future Bicycle Network. Proposed bike routes are suggested for Cooner Street and Nimitz Street between Cooner Street and University Drive (FM 60). These bike routes will help connect other components of the bicycle network on streets with constrained right-of-way. Proposed shared-use paths are anticipated going through the University Plaza shopping center, along Texas Avenue between Lincoln Avenue and the city limits, and along the western half of Poplar Street where the road closure is suggested. Additionally, there are new proposed bike paths along the Foster Avenue extension north of Lincoln Avenue, along Live Oak Street, along Ash Street between Eisenhower Street and Nimitz Street, and along Eisenhower Street between Ash Street and University Drive (FM 60). Similarly, changes are proposed to the Pedestrian Plan within the Bicycle, Pedestrian, and Greenways Master Plan as shown in Map 2.5: Future Pedestrian Network. The proposed shared-use paths from the Bicycle Plan are suggested to be added to the Pedestrian Plan, including through the University Plaza shopping center, along Texas Avenue, and along Poplar Street. Additionally, the Foster Avenue extension is proposed to have sidewalks on both sides of the street and the extension of Avenue A to Eisenhower Street is proposed to have a sidewalk on one side. Page 39 of 206 TE X A S A V E TE X A S A V EUNIVERSITY DRPOPLAR ST LINCOLN AVE NI M I T Z S T EI S E N H O W E R S T F O S T E R A V E JA N E S T COONER ST LIVE OAK ST ASH ST GEORGE BUSH DR EWALTON DRFRANCIS DRGILCHRIST AVESOURCE: ASAKURA ROBINSON M AP 2.4 SHARED USE PATH EXISTING SHARED USE PATH FUNDED/ PROPOSED GRADE SEPARATED CROSSING PROPOSED BIKE ROUTE EXISTING BIKE ROUTE FUNDED/PROPOSED BIKE LANE EXISTING BIKE LANE FUNDED/PROPOSED Future Bicycle Network Page 40 of 206 TE X A S A V E TEX A S A V EUNIVERSITY DRLINCOLN AVENI M I T Z S T EI S E N H O W E R S T F O S T E R A V E JA N E S T COONER STLIVE OAK STASH ST GEORGE BUSH DR EWALTON DRFRANCIS DRGILCHRIST AVEPOPLAR ST SOURCE: ASAKURA ROBINSON MAP 2.5 SIDEWALK FUNDED/PROPOSED SHARED USE PATH FUNDED/ PROPOSED SHARED USE PATH EXISTING GRADE SEPARATED CROSSINGPROPOSED SIDEWALK EXISTING Future Pedestrian Network Page 41 of 206 31CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN The Bicycle, Pedestrian, and Greenways Master Plan currently proposes a bicycle/pedestrian grade- separated facility at Texas Avenue and University Drive (FM 60). In addition to a grade-separated bicycle/ pedestrian facility, facilities that separate traffic while allowing pedestrians and cyclists to remain at grade should be considered. Grade separations can negatively impact cyclist and pedestrian perceptions of safety and convenience, particularly if they add additional travel distance or difficulty or are perceived to be unsafe. In addition to separating the bicycle and pedestrian facilities at this intersection, separating through traffic should be explored, such as lowering northbound/southbound Texas Avenue below grade while maintaining an at-grade, signal-controlled intersection with bicycle and pedestrian facilities. This would potentially mitigate an existing signal phase and improve intersection performance. PROPOSED URBAN STREET CROSS-SECTION Within catalyst sites such as Lone Star Pavilion and University Plaza, modifications to the City’s standard Minor Collector section may be appropriate to provide enhanced facilities, including separated bike lanes buffered from through traffic by on-street parallel parking, street furniture, street tree planting zones, and wide sidewalks. While street trees provide shade, they sometimes conflict with utility provision; care and intention should be shown for the location of trees outside of utility locations. Revisions to the MU Mixed-Use zoning district should include which amenities should be provided with property development The Minor Collector variation shown in Figure 2.3: Proposed Urban Street Cross-Section provides ample space for pedestrians and can support amenities such as sidewalk cafes within privately owned frontages. Although the standard Minor Collector section requires a 60-foot right-of-way, retrofits to existing sections of Ash Street and Nimitz Street must consider the constrained right-of- way (typically 50 feet) and existing pavement section (typically 27 feet). As these sections will provide an important bicycle connection within the existing residential area, future improvements should consider reducing vehicular travel lane widths to manage right-of- way while maintaining adequate fire access and vertical and horizontal separation from bicycle and pedestrian facilities. Although bicycle and pedestrian facilities should ideally be separated to reduce conflicts between users, an alternative shared-use path section may be appropriate where lower bicycle and pedestrian traffic volumes are anticipated. Figure 2.3: Proposed Urban Street Cross-Section Page 42 of 206 32CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN CONNECTED STREET NETWORK Although a street grid can be seen within The Crossing’s residential areas, creating a connected street network will require addressing the larger blocks between the residential areas and the primary corridors, particularly those located between Eisenhower Street and Texas Avenue. Typical block dimensions include 275 feet (between Ash Street and Live Oak Street) by 320 feet (between Eisenhower Street and Nimitz Street), and 300 feet (MacArthur Street to Nimitz Street) by 625 feet (Cooner Street to University Drive (FM 60). Smaller block sizes create a greater variety of route options for travel modes that are more sensitive to distance, such as walking and biking. Currently, the “superblock” bounded by Texas Avenue, Live Oak Street, Eisenhower Street, and Lincoln Avenue is over 1,100 feet and 800 feet on its faces. Though the Future Street Network Plan identifies priority connections for public investment, future redevelopment should include a mix of local streets and bicycle/pedestrian connections that provide additional connectivity. For example, Century Square’s central block is about 350 feet by 550 feet and bounded by vehicular accesses, but the interior of this block contains high-quality pedestrian areas that contribute to this development’s walkability. The Unified Development Ordinance prohibits block lengths greater than 660 feet in Urban Core Context Zones as defined in the Comprehensive Plan. New connections should be designed to connect to existing public streets wherever possible and provide connectivity to adjoining neighborhoods. Offsets and jogs should be avoided or resolved with new intersection designs or realignments, such as the existing jogs of Live Oak Street and Ash Street at Eisenhower Street. TRAFFIC SIGNAL & ACCESS MANAGEMENT The Crossing contains several critical intersections that manage traffic flows to and from College Station’s commercial corridors, the City of Bryan, and Texas A&M University. In addition to the central signalized intersection of Texas Avenue and University Drive (FM 60), traffic signals are present at University Drive (FM 60)’s intersections with Nimitz Street and Tarrow Street, as well as Texas Avenue’s intersections with the access drive to the Lone Star Pavilion shopping center, Walton Drive, and George Bush Drive East. This sidewalk in Northpoint Crossing highlights how tree and furniture placement can reduce attractiveness to pedestrians. Utility infrastructure should not be located in high-traffic areas. Additionally, street trees should not reduce sidewalk width. While the information kiosk obstructs the sidewalk, this sidewalk in Century Square maintains ample space for landscaping as well as bike storage, leaving a wide path for pedestrians. Page 43 of 206 33CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN While the existing signalized intersections are spaced with about 0.2 miles between each signal, nearly reflecting the accepted recommended minimum spacing of a quarter mile between each signal, managing parcel-level access near intersections is a crucial challenge within The Crossing. At the Texas Avenue and University Drive (FM 60) intersection, the presence of driveway and local street accesses such as the existing Exxon gas station, U-Haul location, and Poplar Street negatively impact intersection performance, safety, and pedestrian comfort. Though these accesses are primarily right-in/right-out entrances with raised medians that restrict left-turn movements near the intersection, where there is limited alternative access from local streets, a lack of alternatives can negatively impact perceptions of access near the intersection. Commercial spaces with relatively low connectivity to adjacent areas or requiring additional turning movements have been anecdotally noted to be less desirable. Encouraging internal circulation through street connections and small blocks can help to provide access from side streets, minimize the need for curb cuts and driveway accesses near high-volume intersections, and improve perceptions of access within the area. The presence of secondary streets and internal connections can also support urban development forms with parking located behind or to the side of the primary building in surface lots or parking structures. Future development and improvements to Texas Avenue and University Drive (FM 60) should be coordinated to consider the effectiveness of existing median crossovers with left-turn bays and the potential need for additional signals. PUBLIC TRANSIT Transit improvements can help reduce vehicular usage and limit the impact of increased demand on current infrastructure. The Brazos Transit District (BTD) is considering implementing fixed stops along all of its routes, including the three routes that frequent the area, as the addition of fixed stops could encourage ridership and improve the transit experience. Texas A&M University Transportation Services should also consider adding new fixed stops to the existing 12/Reveille route or rerouting the 12/Reveille service into the future redevelopment of the Lone Star Pavilion shopping center to service the increased housing densities. Additionally, the frequency of the busiest routes, particularly routes that have one hour or greater intervals between buses, should be shortened to ensure reliable service and encourage transit ridership. Lastly, improvements to bus stops, including but not limited to transit shelters and bike racks, will help riders by protecting them from traffic and extreme weather conditions. Transit shelters should be offered in designated furniture zones along transit corridors and bike racks should be installed to allow multi-modal riders the opportunity to lock their vehicles as neither Brazos Transit District nor Texas A&M University Transportation Services have mounted bike racks on their buses. Future opportunities to add mounted bike racks to both transit providers’ buses should be capitalized upon. Page 44 of 206 34CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Strategic Actions The actions listed below are intended to accomplish the City’s goal for creating a vibrant and distinct district that provides sufficient residential and commercial opportunities connected by a safe and comfortable multi-modal mobility system. DISTINCTIVE PLACES C.1 Revise the existing MU Mixed-Use zoning district standards within the Unified Development Ordinance (UDO). The revised zoning district should focus on vertical mixed-use structures and set minimum and maximum square footage requirements for active ground-floor uses, minimum and maximum setbacks, landscaping and open space requirements, a height cap, and other appropriate revisions to realize a more urban form throughout the redevelopment area and the city. C.2 Evaluate amending the MU Mixed-Use zoning district regulations to permit micro-industrial uses with specific use standards. Micro-industrial uses are currently permitted in the GC General Commercial, CI Commercial Industrial, and BPI Business Park Industrial zoning districts. Amendments to the MU Mixed-Use zoning district should include permitting micro-industrial uses such as makerspaces and small-scale manufacturing. C.3 Evaluate open space and plaza requirements within The Crossing to establish at least one large plaza space within the district. As The Crossing redevelops, it will be increasingly important to ensure there is at least one larger public gathering space to enable a sense of community to develop. This can be accomplished through public investment, regulatory changes, or modifications to the parkland dedication requirements. C.4 Create and implement visually intuitive branding for The Crossing and its public spaces. Part of redevelopment will include place-making activities, including visual cues of your location in the city. District branding will help residents and visitors differentiate their experience in this area from the nearby University Drive (FM 60) Corridor, Eastgate Main, Century Square, and Texas A&M University. STRONG NEIGHBORHOODS & PROSPEROUS ECONOMY C.5 Establish appropriate first row parking standards and locations within the district. In other areas of the city, first row parking has been seen as a good addition to denser commercial developments. Finding the right locations for first row parking will enable an urban form to develop while still inviting visitors to park in visible parking areas. INTEGRATED MOBILITY C.6 Assess the feasibility of a grade-separated facility at the Texas Avenue and University Drive (FM 60) intersection. The City should work with TxDOT to study the feasibility, cost, and design of a grade-separated facility. The feasibility analysis should determine whether keeping automotive or bicycle/pedestrian traffic at grade is possible and determine a preferred facility design. C.7 Evaluate closing or pedestrianizing Poplar Street’s terminus at Texas Avenue. Poplar Street is less than 200 feet from Texas Avenue’s intersection with University Drive (FM 60), which does not meet most guidance for access spacing from intersections. This could create opportunities for a deeper block along University Drive (FM 60), enabling more urban types of development. Page 45 of 206 35CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN C.8 Explore and implement improvements to Live Oak Street as redevelopment occurs. Live Oak Street will require improvements to bring it up to Minor Collector standards and alternatives should be considered that implement a more urban street section. There is also an existing offset for Live Oak Street on either side of Eisenhower Street, and a roundabout or other improvements at the intersection should be analyzed for solutions. C.9 Extend Foster Avenue from its terminus at Lincoln Avenue to Live Oak Street as redevelopment occurs. Foster Avenue parallels Texas Avenue from Lincoln Avenue to Gilchrist Street, providing a secondary route. The extension of Foster Avenue north of Lincoln Avenue would continue this route, offering the best opportunity to create The Crossing district. C.10 Create pedestrian connections across Texas Avenue at the Ash Street extension. There is an existing signal at the intersection of the future Ash Street extension and Texas Avenue, but no pedestrian crossing was installed when the intersection was improved. Providing this crossing offers pedestrians another opportunity to cross Texas Avenue at a controlled intersection. C.11 Extend Ash Street from Eisenhower Street to Texas Avenue at the existing signalized intersection as redevelopment occurs. The extension of Ash Street will help complete the thoroughfare network and offer more opportunities for navigation through the district. C.12 Extend Avenue A from its current terminus to Eisenhower Street as redevelopment occurs. Avenue A does not meet the UDO requirements for a turnaround, leading to issues with fire and solid waste service. Extending Avenue A to Eisenhower Street allows for the continued movement of vehicles and would eliminate the service issues for Avenue A. C.13 Improve Nimitz Street from University Drive (FM 60) to Ash Street to the Minor Collector standards. The signal at Nimitz Street and University Drive (FM 60) will likely bring additional traffic down the corridor. Nimitz Street should be improved to better handle the additional circulation and provide bicycle and pedestrian facilities that currently do not exist along the corridor. C.14 Incorporate flexible urban street standards as an alternative within the adopted cross- sections. The cross-section alternative should allow for and encourage on-street parking, potentially limited to one side, and additional bicycle and pedestrian facilities within constrained rights-of-way. Page 46 of 206 36CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Eastgate Main is centered at the intersection of Texas Avenue and New Main Drive/ Walton Drive, containing one of College Station’s historic retail shopping centers and the College Station City Hall. It is bounded by Foster Avenue, George Bush Drive East, Texas Avenue, and Lincoln Avenue, where it interfaces with The Crossing subarea. Designated Neighborhood Center land use in the Comprehensive Plan Future Land Use & Character Map, Eastgate Main anticipates a mix of small-scale commercial, office, and residential uses arranged horizontally and sometimes within mixed-use structures that support surrounding neighborhoods. 3 EASTGATE MAIN Page 47 of 206 37CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN While the Northgate area redeveloped over the past 20 years as a district oriented to students and visitors of Texas A&M University due to its proximity, Eastgate maintains much of its character from the late 1930s and early 1940s as the College Hills Estates subdivision was developed. The subdivision included a shopping village with commercial parcels with retailers and small businesses such as medical offices fronting on Texas Avenue and a distinctive diamond intersection at Texas Avenue and Walton Drive providing a formal entrance into the subdivision and Texas A&M University. Today, Eastgate Main is a small commercial area retaining several one-story retailers, services, and restaurants, with remnants of the original drive lanes visible in the drive aisles and parking areas (also nicknamed the “swoops”) in front of these businesses. The naming of Eastgate Main was inspired by its historical character as the east gate to Texas A&M University and the community’s desire to maintain the original shopping village and main entrance character. Between the diamond intersection and Francis Drive, the commercial area embodies an auto- oriented character, with a frontage lane providing access to several drive-thru and chain restaurants and strip-center retail. The City of College Station’s administrative buildings occupy the block between Francis Drive and Gilchrist Avenue, with the distinctive City Hall building, plaza, and lawn area providing an additional civic landmark within the area before transitioning to single-family homes between Gilchrist Avenue and George Bush Drive East. 1940 photograph of Eastgate shopping village 1939 plat of College Hills Estates Page 48 of 206 38CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Future infill and redevelopment in Eastgate Main can support this historic center of College Station’s residential community. Existing public spaces such as Eastgate Park and the City Hall site also provide opportunities for public gathering spaces and amenities that bring residents together and contribute to the area’s sense of place. Concept Plan Map 3.1: Eastgate Main Concept Plan highlights key design elements and opportunities that can be implemented through future development and investment. With the historic commercial area and the diamond intersection at its center, the Concept Plan focuses on revitalizing the shopping area as a signature public space and gathering area and supporting it with increased housing options, commercial space, and improved bicycle and pedestrian connections. College Station City Hall Page 49 of 206 SOURCE: ASAKURA ROBINSON Eastgate Main Concept Plan CATALYST SITE KEY INTERSECTION TEXAS A&M CAMPUS VISTA PRIORITY PED/BIKE CONNECTION FUTURE LAND USE NEIGHBORHOOD CENTER INSTITUTIONAL/PUBLIC PARKS & GREENWAYS KEY PUBLIC SPACE ACTIVATION TE X A S A V E T E X A S A V EUNIVERSITY DRGEORGE BUSH DR ENEW MAIN DRPOPLAR ST LINCOLN AVEWALTON DRFRANCIS DRNI M I T Z S T EI S E N H O W E R S T F O S T E R A V E JA N E S T COONER ST LIVE OAK ST ASH ST GILCHRIST AVEKey Catalyst Site Primary Arrival Gateway Key Intersection Key Public Space Activation Texas A&M University Vista Priority Ped/Bike Connection Future Land Use Urban Center Neighborhood Center Mixed Residential Institutional/Public Parks & Greenways M AP 3.1 Page 50 of 206 40CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN CHARACTER & URBAN FORM As a historic, present, and future main gateway for College Station with local businesses, public green space, and City Hall, the Eastgate Main Concept Plan anticipates limited redevelopment of the historic commercial area while improving public space amenities and encouraging the creation of new mixed-use and office spaces. Developments and redevelopments should demonstrate context sensitivity, with heights averaging three (3) stories as anticipated in the Comprehensive Plan. Revitalizing the historic commercial area could include façade improvements, restorations, and additions that improve the attractiveness and utility of these spaces while remaining harmonious with the early 1940s design. GATEWAYS & KEY INTERSECTIONS The historic (now signalized) diamond intersection at Texas Avenue and New Main Drive/Walton Drive is a key intersection within Eastgate Main, providing an entrance to Texas A&M University and the College Hills Estates subdivision. This intersection is home to the historic commercial district for the area and green spaces with landscaping and public art and is designated as a key image/design intersection in the Comprehensive Plan. The intersection of Texas Avenue and George Bush Drive East provides views to the Texas A&M University campus for northbound travelers on Texas Avenue and is an important crossing for cyclists using the bike lanes on George Bush Drive East. Several median openings are present within the study area, providing access to Lincoln Avenue, Francis Drive, and Gilchrist Avenue. Future improvements to these intersections, including signalization, could provide an additional crossing of Texas Avenue for cyclists and pedestrians. CATALYST SITES The Concept Plan highlights the strip-center commercial area between the frontage drive aisle and Francis Drive as likely sites for redevelopment due to their prominent location and potential for mixed-use development. These sites could provide improved bicycle and pedestrian connectivity between City Hall and the Walton Drive gateway and generate additional foot traffic for the historic commercial area. Small-scale multi- family development, similar to the existing structure at the corner of Francis Drive and Foster Avenue, could create additional density and housing variety on this block. View facing southeast from Francis Drive and Texas Avenue. View facing north from Francis Drive and Texas Avenue. Page 51 of 206 41CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN DISTINCTIVE PLACES GOAL: Enhance the existing historic identity of Eastgate Main by enabling and incentivizing appropriate and contextual infill, redevelopment, and revitalization. Eastgate Main is a historic gateway to College Station and public comment throughout the planning process highlighted participants’ desire to see the historic shopping center succeed into the future. While smaller in scale than The Crossing and nearby commercial districts such as Century Square and Northgate, the smaller footprint and its adjoining residential neighborhood context help Eastgate Main stand apart from its peers. Its historic nature and distinguishing green space provide an opportunity to create an urban environment that is wholly and uniquely College Station. BUILDING FORM & USE The historic shopping center primarily consists of small, single-story commercial buildings with storefronts, minimal setbacks, and perpendicular parking in front of businesses along the “swoops.” Parapet walls and rooflines create the appearance of varying heights of the front façades. Future development in Eastgate Main should demonstrate sensitivity to the massing and height of existing structures, particularly the historic commercial area and City Hall. Two to three-story mixed-use or commercial/ office buildings can support this area’s continued future while neither overwhelming the historic commercial area and surrounding neighborhood nor rivaling the prominence of City Hall. While a row of parking can be provided in front of businesses, large parking areas are discouraged to orient building façades close to the street, maintaining consistent setbacks and a pedestrian environment. Outside of the “swoops,” vertical mixed- use development is preferred along Texas Avenue, though adding residential uses within the existing commercial area can effectively create a horizontal mixed-use environment. Denser housing types, such as multiplexes, live-work units, and small multi-family buildings fronting on Foster Avenue can also provide a transition between Texas Avenue and the College Hills Estates neighborhood. Possible Branding for Eastgate Main Page 52 of 206 42CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN PUBLIC SPACE Eastgate Main is home to prominent and highly visible City-owned open spaces including Eastgate Park, the plaza and lawn in front of City Hall, and the landscaped area on George Bush Drive East. These spaces vary in their utility as public space; while Eastgate Park is a City park, the City Hall site is a more formal event/programming space, and the George Bush Drive East landscaping is not a formal park but includes berms, mounds, and planting areas. Eastgate Park is the most visited park space within Eastgate Main and it includes both rectangular sections on Foster Avenue and the triangles at Texas Avenue and Walton Drive. Though Eastgate Park is highly divided by Walton Drive and the historic shopping village, the different areas are landscaped with grass, mature trees, and planting beds. The triangles at Texas Avenue and Walton Drive include additional hardscaping, with a public art installation in the northeast triangle. There are no amenities such as seating or trash cans in the park, limiting the park’s current usefulness as a gathering space. Figure 3.1: Eastgate Park Perspective View shows an example of a small improvement to Eastgate Park that could make it more usable. A needs assessment and park plan should be organized for the park to better identify improvement possibilities. Table 3.1 Suggested Development Standards Area Neighborhood Center Max. Stories/Height 4 stories / 60-ft (above 4 stories by exception or with height bonus) Average Number of Stories within Area 3 Vertical Mixed-Use Encouraged. Ground-floor active uses are required on the Texas Avenue corridor between Lincoln Avenue and Francis Drive. Minimum Front Setback 20-ft minimum setback from the curb. Maximum Front Setback If no parking is provided: maximum 30-ft. If a one-way drive aisle and single-loaded 45-degree angled parking are provided: maximum 50-ft. If a two-way drive aisle and double-loaded perpendicular parking is provided in front of the structure: maximum 100-ft. Front Parking Permitted. Side/Rear Parking Encouraged. Building Orientation/ Entrance Location The primary entrance should be facing the street or intersection (if located at an intersection), with precedence to Texas Avenue. Sidewalks Minimum 8-ft. For high-traffic areas, 12-ft and canopy overhangs to provide shade are recommended. Table 3.1 Suggested Development Standards contains example development standards to implement the vision of the plan. These development standards should be used to assist in future ordinance amendments. Page 53 of 206 43CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Some café seating is visible in the northern “swoop’s” limited sidewalk area, highlighting a latent demand for gathering and seating in this area. Reworking the “swoops” to improve walkability in the shopping village could improve the attractiveness of the storefronts and transform Eastgate Park and the intersection into a true gathering space and a main plaza for the district. Figure 3.2: Eastgate Main Rendering shows an improvement scenario that would not require redevelopment of the commercial spaces but would make the northern “swoop” more usable as a plaza. Measurements of the northern “swoop” highlight the excess pavement width, which exceeds 70 feet from curb to curb, with parking on both sides and a two-way travel lane. This pavement width likely reflects the through traffic in this travel lane before the signalized intersection at Texas Avenue and Walton Drive was constructed. This pavement width could support curb and sidewalk extensions in front of the storefronts through the narrowing of travel lanes and the driveways could be evaluated for consolidation and reconfiguration as shown in Figure 3.2: Eastgate Main Rendering. Adopting a shared street approach and replacing the asphalt paving in the “swoops” with textured pavement, bricks, or pavers could allow this area to function as a plaza when closed to traffic. The City should also undertake a study to assess geometric design options to improve the “swoops” as a part of the master plan for Eastgate Park. Figure 3.1: Eastgate Park Perspective View Figure 3.2: Eastgate Main Rendering Page 54 of 206 44CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN ARTS, CULTURE & PROGRAMMING Partnerships between the City’s Parks and Recreation Department and the Eastgate Main commercial community could activate Eastgate Park as a venue for events, festivals, and markets. Temporarily closing the “swoops” to vehicular traffic would create a low-cost street festival atmosphere, with vendors and tents occupying existing parking areas. The City Hall plaza is another important venue for programming, with ample parking for events. Establishing a programming schedule in this area will require coordination between the City and Eastgate’s commercial community. The City should work with the business community to support the development of a business association or provide ongoing support for marketing and event coordination in Eastgate Main, similar to prior efforts in Northgate. The use of paving patterns, planting, and bollards in Century Square shows how parking areas and storefronts can be separated while maintaining flexibility for both vehicles and pedestrians. Page 55 of 206 45CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Strong Neighborhoods and a Prosperous Economy GOAL: Support the interests of current residents and businesses while redevelopment occurs. Although Eastgate Main anticipates a lower level of infill and redevelopment, there is always the potential for unintended impacts on existing residents and businesses. The City should support changes that will enhance the area, including the interests of the existing community. That may come through the development of and direct engagement with an Eastgate Business Association or another engagement mechanism. ECONOMIC DEVELOPMENT Eastgate Main is home to long-time residents and small businesses, including offices, bakeries and restaurants, retailers, and service providers. Many of these businesses own their buildings and depend on vehicular traffic to access their customer base. Festivals held in the plaza area by pedestrianizing the “swoops” could also provide opportunities to highlight the businesses located in Eastgate Main. Figure 3.3: Dining Box Perspective View shows a business expanding their usable space by including a dining box. Future construction and redevelopment should work with business owners to minimize disruptions to parking availability and customer access. Figure 3.3: Dining Box Perspective View Page 56 of 206 46CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Future economic development strategies should continue to encourage the retention and growth of businesses within Eastgate Main. Redevelopment of auto-oriented parcels could include new office spaces that provide daytime foot traffic to Eastgate Main’s businesses, including spaces for larger employers that would not fit within smaller historic structures. Additionally, any city participation in a public-private partnerships or development agreement should consider anti-displacement measures. INFILL & REDEVELOPMENT Redevelopment within the Eastgate Main area should respect existing historic structures and character of the area. While no structures within Eastgate Main are formally protected or recognized with historic markers, the 1941 Walton Medical Building at 903 Texas Avenue is listed in the Brazos Heritage Society’s 2003 Guide to Historic Brazos County. Future modifications to these buildings such as façade improvements should maintain similar setbacks and massing, and taller additions may be appropriate if stepped back from the original elevation. Integrated Mobility GOAL: Strengthen the existing multi-modal mobility system to support a diversity of modes of travel. As infill and redevelopment occur, a stronger mobility system will enable residents of the planning area and the surrounding neighborhoods to access the improvements. Enabling mobility options empowers choice in navigation, reducing the overall congestion on …. FUTURE STREET NETWORK Map 3.2: Future Street Network does not propose significant new connections within this area, as adequate connectivity is already provided between Foster Avenue and Texas Avenue. Foster Avenue, Walton Drive, and Francis Drive are existing Minor Collectors with a mix of dedicated bike lanes and shared routes for bicycles and automobiles, as well as planned shared-use paths. The southern boundary of Eastgate Main, George Bush Drive East, is classified as a 4 Lane Minor Arterial in the City’s Thoroughfare Plan, and the northern boundary, Lincoln Avenue, is a 2 Lane Major Collector with planned shared-use paths on both sides. Page 57 of 206 SOURCE: ASAKURA ROBINSON TE X A S A V E T E X A S A V EUNIVERSITY DRPOPLAR ST LINCOLN AVENI M I T Z S T EI S E N H O W E R S T F O S T E R A V E JA N E S T COONER ST LIVE OAK ST ASH ST 6 LANE MAJOR ARTERIAL 4 LANE MAJOR ARTERIAL 4 LANE MINOR ARTERIAL 2 LANE MAJOR COLLECTOR PROPOSED 2 LANE MAJOR COLLECTOR 2 LANE MINOR COLLECTOR PROPOSED 2 LANE MINOR COLLECTOR RECOMMENDED STREET EXTENSION RECOMMENDED STREET CLOSURE Future Street Network MAP 3.2 Page 58 of 206 48CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN HIGH-COMFORT BICYCLE & PEDESTRIAN FACILITIES Eastgate Main’s small blocks and connected street network allow easy and convenient access within Eastgate Main. The area is also an important hub for pedestrians and cyclists seeking to connect from Texas A&M University to the nearby College Hills Estates and College Hills Woodlands neighborhoods, and from the Harvey Road corridor along Foster Avenue. Map 3.3: Future Bicycle Network shows the proposed bicycle connections through the district. Foster Avenue, Francis Drive, and Gilchrist Avenue are currently signed as bike routes with shared lanes for bicycles and automobiles. Bike lanes currently exist on Lincoln Avenue and Walton Drive and are proposed on Francis Drive. Shared-use paths are currently planned on both sides of Lincoln Avenue. The only addition to the bicycle network is the grade-separated crossing at Texas Avenue and George Bush Drive East. All design options for such a facility should be explored to determine the best possible outcome. Page 59 of 206 TE X A S A V E TE X A S A V EUNIVERSITY DRPOPLAR ST LINCOLN AVE NI M I T Z S T EI S E N H O W E R S T F O S T E R A V E JA N E S T COONER ST LIVE OAK ST ASH ST GEORGE BUSH DR EWALTON DRFRANCIS DRGILCHRIST AVESOURCE: ASAKURA ROBINSON M AP 3.3 SHARED USE PATH EXISTING SHARED USE PATH FUNDED/ PROPOSED GRADE SEPARATED CROSSING PROPOSED BIKE ROUTE EXISTING BIKE ROUTE FUNDED/PROPOSED BIKE LANE EXISTING BIKE LANE FUNDED/PROPOSED Future Bicycle Network Page 60 of 206 50CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Additionally, Map 3.4: Future Pedestrian Network shows the network of pedestrian facilities through the planning area. In Eastgate Main, the only addition to the Pedestrian Plan is the sidewalks along the “swoops” to create better connectivity from Texas Avenue to Foster Avenue and Walton Drive. The proposed grade-separated crossing at Texas Avenue and George Bush Drive East is also proposed to be added. As micromobility ridership grows, including electric and non-electric bicycles, scooters, and skateboards, the provision of a network of safe facilities will become increasingly important. Missing sidewalks along the “swoops Page 61 of 206 T E X A S A V E T E X A S A V EUNIVERSITY DRLINCOLN AVENI M I T Z S T EI S E N H O W E R S T F O S T E R A V E JA N E S T COONER STLIVE OAK STASH ST GEORGE BUSH DR EWALTON DRFRANCIS DRGILCHRIST AVEPOPLAR ST SOURCE: ASAKURA ROBINSON M AP 3.4 SIDEWALK FUNDED/PROPOSED SHARED USE PATH FUNDED/PROPOSED SHARED USE PATH EXISTING GRADE SEPARATED CROSSING PROPOSED SIDEWALK EXISTING Future Pedestrian Network Page 62 of 206 52CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Bike lanes, buffered bike lanes, or separated bike lanes are preferable to shared bike routes on high-speed or high-traffic corridors. They provide physical separation from automobile traffic, and continuous, high- comfort lanes without gaps or interruptions can be highly preferable routes for cyclists. They are also relatively low-cost interim improvements that can be implemented within existing pavement widths with paint, and the addition of vertical barriers such as planters and precast concrete curbs can provide an added degree physical separation. However, vertical barriers may not be appropriate when frequent curb cuts such as driveways are present on the corridor. TRAFFIC SIGNAL & ACCESS MANAGEMENT Texas Avenue within Eastgate Main currently has signalized intersections at New Main Drive/Walton Drive and George Bush Drive East. Median openings with left turn bays currently exist at Lincoln Avenue, the entrance to the frontage access road serving Raising Cane’s and Torchy’s Tacos, Francis Drive, and Gilchrist Avenue. Over time, traffic volumes caused by continued growth within the College Station area and Texas A&M University, as well as redevelopment within the Eastgate Main and The Crossing areas, may necessitate replacing these median openings with a different design. While a warrant analysis will be required to determine its need, Francis Drive would likely be the most appropriate location for an additional signalized intersection within Eastgate Main due to its spacing from Walton Drive (0.2 miles) and George Bush Drive East (0.28 miles) and its continuity through the College Hills Estates and College Hills Woodlands neighborhoods. A signalized intersection at Francis Drive would provide an additional crossing opportunity for cyclists and pedestrians to access the Texas A&M University campus. Planters used in temporary installation. Page 63 of 206 53CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN PARKING MANAGEMENT Future redevelopment within the Eastgate Main area will need to consider the location and availability of parking, which stands in contrast to the excess parking currently within The Crossing. The historic shopping village has little off-street parking, with the “swoops” providing the primary parking for visitors and limited off-street parking available for employees in the alleyways behind the buildings. The suburban-style strip development along the frontage road between the shopping village and Francis Drive has ample on-site parking provided. No parking is available at Eastgate Park, and on-street parking is prohibited along most of Foster Avenue. Public parking is available at City Hall. As Eastgate Main redevelops, the City should develop a parking management strategy that maintains on-street parking in front of businesses, encourages shared parking across users and property owners, manages overflows and peak demand during events, and helps visitors identify parking areas through signage and awareness. Parking availability is likely to be a major concern for businesses with future development, and proactive management and study will alleviate this concern. Strategic Actions DISTINCTIVE PLACES E.1 Revise the existing P-MUD Planned Mixed-Use District standards within the Unified Development Ordinance. The revised zoning district should focus on horizontally mixing uses within a development or defined area, ensuring sufficient commercial and residential opportunities throughout the district. The revisions should maintain the concept plan requirement and clarify an appropriate baseline mix of uses. E.2 Create a master plan for Eastgate Park. These park spaces are currently unprogrammed, landscaped lawns with no amenities or seating. Identifying opportunities for Eastgate Park to become a usable community gathering space distinct from the plaza and lawn at City Hall will open more opportunities for place-making. E.3 Assess the feasibility of temporarily closing the “swoops” to through traffic. Temporarily pedestrianizing the “swoops” and converting parking spaces and drive aisles could create a street festival-style atmosphere for events such as markets and festivals. Closures should consider traffic and parking impacts on businesses and surrounding neighborhoods. E.4 Activate the City Hall site to host public events and gatherings that bring residents and tourists to the center of Eastgate Main. With the development of the new City Hall in 2021 and the rehabilitation of the old fire station in 2023, the City of College Station has developed a municipal complex that can be activated to host community events throughout the year. Page 64 of 206 54CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN E.5 Create and implement visually intuitive branding for Eastgate Main and its public spaces. Part of redevelopment will include place-making activities, including visual cues of your location in the city. District branding will help residents and visitors differentiate their experience in this area from the nearby Eastgate neighborhoods, The Crossing, and Texas A&M University. E.6 Create opportunities for residents to engage with the history of the area. Eastgate Main was part of one of the earliest developments in College Station. Opportunities include signage discussing the history of the area and identification of historic buildings. STRONG NEIGHBORHOODS & PROSPEROUS ECONOMY E.7 Create a façade improvement program for Eastgate Main. A façade improvement program could provide grants for building owners to improve the appearance of their façades and restore architectural styles from the founding of the City of College Station and the initial development of the Eastgate Main area in the late 1930s and early 1940s. E.8 Work with property owners to assess the potential need, benefit, and structure of creating an Eastgate Business Association. An Eastgate Business Association could collectively initiate actions to improve the Eastgate Main area and coordinate hosting local events in the plaza area at Eastgate Park. Additionally, having an Eastgate Business Association enables more coordination with City staff, including updates on development activity and City projects within the district. INTEGRATED MOBILITY E.9 Study traffic operations and access needs on the Texas Avenue corridor to assess the need for changes to median break locations and future signalized intersections. Several unsignalized median openings with left-turn bays exist along Texas Avenue, including at Live Oak Street, the entrance to the Lone Star Pavilion shopping center, Lincoln Avenue, the frontage road near the “swoops,” Francis Drive, and Gilchrist Avenue. Future modifications to these intersections should review traffic volumes and crossing movements to enhance traffic safety and operations. E.10 Evaluate the intersection of Foster Avenue and George Bush Drive East to determine necessary improvements. Traffic frequently backs up on Foster Avenue at this intersection. The City should explore congestion mitigation improvements including possible dedicated left and right turn lanes. E.11 Assess the feasibility of a grade-separated facility at the Texas Avenue and George Bush Drive intersection. The City should work with TxDOT to study the feasibility, cost, and design of a grade-separated facility. The feasibility analysis should determine whether keeping automotive or bicycle and pedestrian traffic at grade is possible and determine a preferred facility design. E.12 Improve bicycle and pedestrian connections to Thomas Park along Walton Drive, Francis Drive, and Gilchrist Avenue. Located nearby Eastgate Main, Thomas Park is one of the more significant park spaces in this area of the city. As more potential users of the park move into the planning area, improved connections to the park should be explored. E.13 Develop an Eastgate Main parking management strategy. This could include improving existing parking within the “swoops” and creating shared parking areas that are easily accessed from the surrounding streets. Page 65 of 206 55CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN The Northeast Gateway Redevelopment Plan lays out a new vision for a key redevelopment area, corridor, and intersection for the City of College Station. Implementation requires collaboration between the City, Texas A&M University, and the community to achieve the goals of this plan. This chapter lays out planning considerations, implementation methods, and funding sources for accomplishing the goals and actions contained within the plan. This chapter also includes several actions that should be pursued across the entire planning area. Additionally, Table 4.1: Implementation Matrix outlines the timeframe, establishes implementation responsibilities and administration, and determines possible funding sources for actions within the plan. 4 PLAN IMPLEMENTATION Page 66 of 206 56CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Key Considerations FISCAL HEALTH Redevelopment within the Northeast Gateway Redevelopment Area will require both public and private investment, and the City of College Station must balance both the increased tax revenues and the increased demand for services that come with redevelopment. While urban areas may appear on the surface to require greater investment in infrastructure than suburban areas, research has found that increased density allows infrastructure to be provided more efficiently on a per- capita or per-acre basis.1 The greater amount of real property improvement translates to increased real property values and tax revenues, and strong hospitality and retail sectors can support increased revenues through sales taxes and hotel occupancy taxes. Although redevelopment can support long-term revenues, College Station will need to coordinate near- and mid-term investments to catalyze redevelopment. TARGETED INVESTMENT A major Special Revenue Fund for the City of College Station is the Hotel Occupancy Tax (HOT) Fund. Hotel occupancy taxes can be used to enhance and promote tourism and the convention and hotel industry and can support administrative and programming costs through the HOT Fund. While expenditure categories are defined by statute, they can include tourism advertising and promotion, funding programs that enhance the arts, funding mobility systems for tourists, and signage and wayfinding directing the public to sights and attractions frequented by visitors to the community. Because of this area’s proximity to Texas A&M University, its existing hotel presence, and the location of the Visitor Center at the City Hall complex, the HOT fund may be a viable tool with which to fund activities in the planning area. Because of the extent of redevelopment anticipated within this area, College Station should explore establishing a special taxing entity such as a Tax Increment Reinvestment Zone (TIRZ) to capture new revenues and provide dedicated funding for redevelopment. A TIRZ captures the added real property tax revenues above “base year” revenues (when the TIRZ is established) that are attributable to new development within a designated reinvestment zone. These new revenues are then set aside in a stand- alone fund that is used to reinvest in public infrastructure within the area. Two important considerations with TIRZ financing are impacts on the City’s General Fund since the revenues above the base year will be dedicated to the TIRZ rather than the General Fund, and its financial viability to support projects based on revenues over time. Two TIRZs are present within the City, including East Medical District TIRZ #19 and the Dartmouth Synthetic TIRZ. TIRZ funds can finance projects through a pay-as-you-go method or as the security for debt financing. Should the City pursue active management of parking facilities, such as City-owned or City-operated paid on-street parking or off-street lots or structures, it may be appropriate to create an Enterprise fund to support operations. The City currently maintains a Northgate Parking Fund that allocates parking revenues for operational costs in the Northgate area. The Community Services department also provides staffing and administrative services for Northgate. Page 67 of 206 57CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN LAND USE AND ZONING UPDATES City staff are currently exploring options to improve the City’s provisions for mixed-use and middle housing development, including text and map amendments for the existing MH Middle Housing, MU Mixed-Use, and P-MUD Planned Mixed-Use districts. The current MU Mixed-Use zoning district is primarily focused on vertical mixed-use development, and horizontal mixed-use development is covered through the P-MUD Planned Mixed-Use District process. Potential modifications include the use of density/height caps and aligned bonuses, ground floor use requirements, percentage requirements to ensure mixes of residential and non-residential uses, and dimensional standards. Proactive zoning map amendments may be needed after the zoning districts are established to fully realize the vision in the Comprehensive Plan and this plan. Implementation Methods Generally, the actions of this plan fall into one of five categories: capital improvement, focused planning effort, policy-based decision, project/program, or regulation. Implementation of each category requires unique approaches and produces different results. Table 4.1: Implementation Matrix indicates the most appropriate implementation method for each action. CAPITAL IMPROVEMENTS Capital improvements are large-scale infrastructure projects that the City pursues through the Capital Improvement Projects department. These expansion, modification, rehabilitation, and replacement projects include streets, utilities, parks, and public facilities and buildings. To be implemented, actions in this category need to be added to the Capital Plan, funded, and constructed. FOCUSED PLANNING EFFORTS Focused planning efforts are studies, plans, and designs that various City departments complete to identify specific steps needed for implementation. Actions in this category need to be analyzed with resulting recommendations. Implementation of the recommendations is commonly pursued under a different action. This Northeast Gateway Redevelopment Plan is a focused planning effort that also indicates additional studies that are needed, particularly related to mobility improvements within the planning area. POLICY-BASED DECISIONS Policy-based decisions are direction that the Planning and Zoning Commission and City Council provide to City staff. These decisions get implemented in various policy, regulatory, and guidance documents to implement the direction from the elected and appointed officials of College Station. Direction should be sought on actions in this category, and City staff should take the appropriate steps for implementation. Page 68 of 206 58CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN PROJECTS AND PROGRAMS Projects and programs are the broadest category of plan actions. These can include projects that are not considered capital improvements and programs that the City organizes administratively. Implementation of actions in this category should be assessed individually as there are a variety of ways accomplish these actions. Generally, the action provides an indication of what implementation should consider and how it might be implemented. REGULATIONS Regulations are developed by the City to guide or permit allowable activities within College Station. These can include modifications to the City of College Station Code of Ordinances, including the Unified Development Ordinance (UDO), or another regulatory document under the jurisdiction of the City of College Station. To be implemented, actions in this category should be adopted in their respective regulatory documents. Funding Funding for plan actions come from a variety of sources. Generally, the actions in the Northeast Gateway Redevelopment Plan can be funded by one or more of the following sources: City department budgets, the Capital Improvement Projects fund, state and federal grants, and/or private investment. All funding options should be explored, but Table 4.1: Implementation Matrix indicates the funding mechanisms that City staff have identified as most appropriate or likely to complete the action. DEPARTMENTAL BUDGETS Funding projects through City departmental budgets can be accomplished in two ways: using available funds and directing them towards the project or through service level adjustments (SLAs). SLAs are approved as part of the annual City budget process and can be for one-time or recurring expenses. CAPITAL IMPROVEMENTS Capital improvements are most likely to be funded through the Capital Improvement Program funds. The projects from these funds are prioritized and budgeted on a rolling five-year Capital Plan. These funds are also allocated during the annual City budget process as one-time expenses. STATE AND FEDERAL FUNDING Funding opportunities from the state and federal government are also available, particularly in the areas of transportation and the environment. These funds are primarily available through grants but may also be through specific budget appropriations. Often, grant funding includes local matching requirements. PRIVATE INVESTMENTS Outside of government funding, private investments can be pursued through development exactions within the UDO, foundation investments, or donations to the City for specific projects. Page 69 of 206 59CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Area-Wide Actions DISTINCTIVE PLACES A.1 Create a consistent wayfinding system based on the district branding to help people navigate the district. Using each district’s branding, a wayfinding system should be developed to enable and encourage exploration of the planning area and spotlight specific shops and services. A.2 Develop and implement a pedestrian-scale street lighting system. Work to determine a standard in accordance with the College Station Utilities Construction Specifications, Electric Service, and Meter Installation Guidelines. The feeling of safety in an area is directly tied to its success, and streetlights generally make a district feel safer. STRONG NEIGHBORHOODS & PROSPEROUS ECONOMY A.3 Establish a density/height bonus program to encourage public benefits as a component of development. While state enabling authority does not permit municipalities to require affordable housing in new development, future zoning updates can incentivize public benefits through height or density bonus provisions. Potential benefits could include affordable housing, art installations or contributions to art funds, or additional public open space and landscaping, among other options. A.4 Establish an affordable housing incentives program or programs. This can include the height cap and density program, tax incentives, tax increment financing, grant programs, and other City-initiated tools to ensure the affordability of both new and existing housing stock. These programs should be aimed at both affordable and workforce housing and income levels to ensure continued affordability within the district. A.5 Establish a Legacy Business Program to recognize and support longtime small businesses. Legacy business programs nominate and recognize small local businesses meeting certain criteria such as longevity, family ownership, historic status, and cultural contributions to the community. In addition to public recognition, designation as a Legacy Business can also provide eligibility for grant funding (such as façade improvements or renovations) or targeted technical assistance to ensure the business’ continued longevity. A.6 Commission a market study to understand space needs and capacity within the redevelopment area. This could also extend to a citywide scale to analyze the market needs for additional retail, commercial, and hospitality uses throughout the community. A.7 Study the feasibility of establishing a Tax Increment Reinvestment Zone (TIRZ) to reinvest in the area. This study should include cost estimates for projects that could be funded by a TIRZ and a detailed study of redevelopment potential and year-to-year revenues to support potential financing. INTEGRATED MOBILITY A.8 Coordinate with Brazos Transit District to establish fixed stops and improve service provision from existing conditions. The location of the new fixed stops should be explored to maximize efficacy and access to areas that are important to transit passengers. Page 70 of 206 Table 4.1: Implementation Matrix CHAPTERSECTIONACTION NUMBERACTION ITEM TASK TYPE IMPLEMENTATION TIMELINE CITY - RESPONSIBLE PARTY PARTNERS - INTERNAL PARTNERS - EXTERNAL FUNDING SOURCES Short (1-3 years) Medium (4-7 years) Long (8-10 years)CITY / DEPT. BUDGETSCIP BUDGETGRANTSPRIVATEAREA-WIDE ACTIONSDISTINCTIVE PLACESA.1 Create a consistent wayfinding system based on the district branding to help people navigate the district. Using each district’s branding, a wayfinding system should be developed to enable and encourage exploration and spotlight specific locations around the planning area. Project / program X Capital Improvement ProjectsPlanning & Development Services Economic Development & Tourism X X X X A.2 Develop and implement a pedestrian-scale street lighting system. Work to determine a standard in accordance with the College Station Utilities Construction Specifications, Electric Service, and Meter Installation Guidelines. The feeling of safety in an area is directly tied to its success, and streetlights generally make a district feel safer. Project / program X Capital Improvement ProjectsPlanning & Development Services CSU - Electric Police X X X STRONG NEIGHBORHOODS & PROSPEROUS ECONOMYA.3 Establish a density/height bonus program to encourage public benefits as a component of development. While state enabling authority does not permit municipalities to require affordable housing in new development, future zoning updates can incentivize public benefits through height or density bonus provisions. Potential benefits could include affordable housing or commercial spaces, art installations or contributions to art funds, or additional public open space and landscaping, among other options. Policy-based decision X Planning & Development Services Community Services X X A.4 Establish an affordable housing incentives program or programs. This can include the height cap and density program, tax incentives, tax increment financing, grant programs, and other City-initiated tools to ensure the affordability of both new and existing housing stock. These programs should be aimed at both affordable and workforce housing and income levels to ensure continued affordability within the district. Policy-based decision X Community ServicesPlanning & Development Services Fiscal Services X X X A.5 Establish a Legacy Business Program to recognize and support longtime small businesses. Legacy business programs nominate and recognize small local businesses meeting certain criteria such as longevity, family ownership, historic status, and cultural contributions to the community. In addition to public recognition, designation as a Legacy Business can also provide eligibility for grant funding (such as façade improvements or renovations) or targeted technical assistance to ensure the business’ continued longevity. Project / program X Economic Development & Tourism Community Services X X A.6 Commission a market study to understand space needs and capacity within the redevelopment area. This could also extend to a citywide scale to analyze the market needs for additional retail, commercial, and hospitality uses throughout the community. Project / program X Economic Development & TourismPlanning & Development Services X A.7 Study the feasibility of establishing a Tax Increment Reinvestment Zone (TIRZ) to reinvest in the area. This study should include cost estimates for projects that could be funded by a TIRZ and a detailed study of redevelopment potential and year-to-year revenues to support potential financing. Policy-based decision X Economic Development & Tourism Planning & Development ServicesFiscal ServicesCity Manager’s Office X INTEGRATEDMOBILITYA.8 Coordinate with Brazos Transit District to establish fixed stops and improve service provision from existing conditions. The location of the new fixed stops should be explored to maximize efficacy and access to areas that are important to transit passengers. Project / program X Planning & Development Services Capital Improvement Projects X X Page 71 of 206 CHAPTER 2: THE CROSSINGDISTINCTIVE PLACESC.1 Revise the existing MU Mixed-Use zoning district standards within the Unified Development Ordinance (UDO). The revised zoning district should focus on vertical mixed-use structures and set minimum and maximum square footage requirements for active ground-floor uses, minimum and maximum setbacks, landscaping and open space requirements, a height cap, and other appropriate revisions to realize a more urban form throughout the redevelopment area and the city. Regulation X Planning & Development Services X C.2 Evaluate amending the MU Mixed-Use zoning district regulations to permit micro-industrial uses with specific use standards. Micro-industrial uses are currently permitted in the GC General Commercial, CI Commercial Industrial, and BPI Business Park Industrial zoning districts. Amendments to the MU Mixed-Use zoning district should include permitting micro-industrial uses such as makerspaces and small-scale manufacturing. Regulation X Planning & Development Services X C.3 Evaluate open space and plaza requirements within The Crossing to establish at least one large plaza space within the district. As The Crossing redevelops, it will be increasingly important to ensure there is at least one larger public gathering space to enable a sense of community to develop. This can be accomplished through public investment, regulatory changes, or modifications to the parkland dedication requirements. Regulation X Planning & Development Services Parks & Recreation X X C.4 Create and implement visually intuitive branding for The Crossing and its public spaces. Part of redevelopment will include place-making activities, including visual cues of your location in the city. District branding will help residents and visitors differentiate their experience in this area from the nearby University Drive (FM 60) Corridor, Eastgate Main, Century Square, and Texas A&M University. Project / program X Capital Improvement ProjectsPlanning & Development Services Economic Development & Tourism X X STRONG NEIGHBORHOODS & PROSPEROUS ECONOMYC.5 Establish appropriate first row parking standards and locations within the district. In other areas of the city, first row parking has been seen as a good addition to denser commercial developments. Finding the right locations for first row parking will enable an urban form to develop while still inviting visitors to park in visible parking areas.Regulation X Planning & Development Services X INTEGRATED MOBILITYC.6 Assess the feasibility of a grade-separated facility at the Texas Avenue and University Drive (FM 60) intersection. The City should work with TxDOT to study the feasibility, cost, and design of a grade-separated facility. The feasibility analysis should determine whether keeping automotive or bicycle/pedestrian traffic at grade is possible and determine a preferred facility design. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works Texas Department of TransportationBCS Metropolitan Planning OrganizationTexas A&M University X X C.7 Evaluate closing or pedestrianizing Poplar Street’s terminus at Texas Avenue. Poplar Street is less than 200 feet from Texas Avenue’s intersection with University Drive (FM 60), which does not meet most guidance for access spacing from intersections. This could create opportunities for a deeper block along University Drive (FM 60), enabling more urban types of development. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works Texas Department of Transportation X X C.8 Explore and implement improvements to Live Oak Street as redevelopment occurs. Live Oak Street will require improvements to bring it up to Minor Collector standards and alternatives should be considered that implement a more urban street section. There is also an existing offset for Live Oak Street on either side of Eisenhower Street, and a roundabout or other improvements at the intersection should be analyzed for solutions. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works Texas Department of Transportation X X C.9 Extend Foster Avenue from its terminus at Lincoln Avenue to Live Oak Street as redevelopment occurs. Foster Avenue parallels Texas Avenue from Lincoln Avenue to Gilchrest Street, providing a secondary route. The extension of Foster Avenue north of Lincoln Avenue would continue this route, offering the best opportunity to create The Crossing district. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works X X C.10 Create pedestrian connections across Texas Avenue at the Ash Street extension. There is an existing signal at the intersection of the future Ash Street extension and Texas Avenue, but no pedestrian crossing was installed when the intersection was improved. Providing this crossing offers pedestrians another opportunity to cross Texas Avenue at a controlled intersection. Capital improvement X Public Works Planning & Development Services Texas Department of Transportation X C.11 Extend Ash Street from Eisenhower Street to Texas Avenue at the existing signalized intersection as redevelopment occurs. The extension of Ash Street will help complete the thoroughfare network and offer more opportunities for navigation through the district. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works Texas Department of Transportation X X C.12 Extend Avenue A from its current terminus to Eisenhower Street as redevelopment occurs. Avenue A does not meet the UDO requirements for a turnaround, leading to issues with fire and solid waste service. Extending Avenue A to Eisenhower Street allows for the continued movement of vehicles and would eliminate the service issues for Avenue A. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works X X C.13 Improve Nimitz Street from University Drive (FM 60) to Ash Street to the Minor Collector standards. The signal at Nimitz Street and University Drive (FM 60) will likely bring additional traffic down the corridor. Nimitz Street should be improved to better handle the additional circulation and provide bicycle and pedestrian facilities that currently do not exist along the corridor. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works X C.14 Incorporate flexible urban street standards as an alternative within the adopted cross-sections. The cross-section alternative should allow for and encourage on-street parking, potentially limited to one side, and additional bicycle and pedestrian facilities within constrained rights-of-way. Policy-based decision X Planning & Development Services X Page 72 of 206 CHAPTER 3: EASTGATE MAINDISTINCTIVE PLACESE.1 Revise the existing P-MUD Planned Mixed-Use District standards within the Unified Development Ordinance. The revised zoning district should focus on horizontally mixing uses within a development or defined area, ensuring sufficient commercial and residential opportunities throughout the district. The revisions should maintain the concept plan requirement and clarify an appropriate baseline mix of uses. Regulation X Planning & Development Services X E.2 Create a master plan for Eastgate Park. These park spaces are currently unprogrammed, landscaped lawns with no amenities or seating. Identifying opportunities for Eastgate Park to become a usable community gathering space distinct from the plaza and lawn at City Hall will open more opportunities for place-making. Focused planning effort X Parks & Recreation Planning & Development Services X E.3 Assess the feasibility of temporarily closing the “swoops” to through traffic. Temporarily pedestrianizing the “swoops” and converting parking spaces and drive aisles could create a street festival-style atmosphere for events such as markets and festivals. Closures should consider traffic and parking impacts on businesses and surrounding neighborhoods. Project / program X Planning & Development Services Public Works X E.4 Activate the City Hall site to host public events and gatherings that bring residents and tourists to the center of Eastgate Main. With the development of the new City Hall in 2021 and the rehabilitation of the old fire station in 2023, the City of College Station has developed a municipal complex that can be activated to host community events throughout the year. Project / program X Economic Development & Tourism X E.5 Create and implement visually intuitive branding for Eastgate Main and its public spaces. Part of redevelopment will include place-making activities, including visual cues of your location in the city. District branding will help residents and visitors differentiate their experience in this area from the nearby Eastgate neighborhoods, The Crossing, and Texas A&M University. Project / program X Capital Improvement ProjectsPlanning & Development Services Economic Development & Tourism X E.6 Create opportunities for residents to engage with the history of the area. Eastgate Main was part of one of the earliest developments in College Station. Opportunities include signage discussing the history of the area and identification of historic buildings. Project / program X Planning & Development Services Economic Development & TourismParks & Recreation X X X STRONG NEIGHBORHOODS & PROSPEROUS ECONOMYE.7 Create a façade improvement program for Eastgate Main. A façade improvement program could provide grants for building owners to improve the appearance of their façades and restore architectural styles from the founding of the City of College Station and the initial development of the Eastgate Main area in the late 1930s and early 1940s. Project / program X Economic Development & Tourism Planning & Development Services X X X E.8 Work with property owners to assess the potential need, benefit, and structure of creating an Eastgate Business Association. An Eastgate Business Association could collectively initiate actions to improve the Eastgate Main area and coordinate hosting local events in the plaza area at Eastgate Park. Additionally, having an Eastgate Business Association enables more coordination with City staff, including updates on development activity and City projects within the district. Project / program X Economic Development & Tourism Planning & Development Services Eastgate Business Owners X X INTEGRATED MOBILITYE.9 Study traffic operations and access needs on the Texas Avenue corridor to assess the need for changes to median break locations and future signalized intersections. Several unsignalized median openings with left-turn bays exist along Texas Avenue, including at Live Oak Street, the entrance to the Lone Star Pavilion shopping center, Lincoln Avenue, the frontage road near the “swoops,” Francis Drive, and Gilchrist Avenue. Future modifications to these intersections should review traffic volumes and crossing movements to enhance traffic safety and operations. Focused planning effort X Planning & Development Services Public Works Texas Department of Transportation X X E.10 Evaluate the intersection of Foster Drive and George Bush Drive East to determine necessary improvements. Traffic frequently backs up on Foster Drive at this intersection. The City should explore congestion mitigation improvements including possible dedicated left and right turn lanes. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works X X E.11 Assess the feasibility of a grade-separated facility at the Texas Avenue and George Bush Drive intersection. The City should work with TxDOT to study the feasibility, cost, and design of a grade-separated facility. The feasibility analysis should determine whether keeping automotive or bicycle and pedestrian traffic at grade is possible and determine a preferred facility design. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works Texas Department of TransportationBCS Metropolitan Planning OrganizationTexas A&M University X X E.12 Improve bicycle and pedestrian connections to Thomas Park along Walton Drive, Francis Drive, and Gilchrist Avenue. Located nearby Eastgate Main, Thomas Park is one of the more significant park spaces in this area of the city. As more potential users of the park move into the planning area, improved connections to the park should be explored. Capital improvement X Planning & Development ServicesCapital Improvement Projects Public Works X X E.13 Develop an Eastgate Main parking management strategy. This could include improving existing parking within the “swoops” and creating shared parking areas that are easily accessed from the surrounding streets.Focused planning effort X Planning & Development Services Public Works X Page 73 of 206 63CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN APPENDIX A: EXISTING CONDITIONS Surrounding Context The planning area is bounded by the College Station-Bryan city limit to the north, Tarrow Street to the east, George Bush Drive East to the south, and the Northpoint Crossing development to the west. Most of the western boundary is the Texas A&M University campus, while most of the eastern boundary is comprised of the Prairie View Heights and Eastgate neighborhoods. Texas A&M University is a major component of the City of College Station with significant influence on the proposed development within this area. Texas A&M University’s College Station campus consistently ranks in the top five universities with the largest enrollment nationally and is the biggest employer in the region as identified by the Brazos Valley Economic Development Corporation, making Texas A&M University an important hub for a significant portion of the regional population. The location of the redevelopment area necessitates careful consideration of the University’s goals for their eastern boundary and inter- organizational collaboration to create cohesion across Texas Avenue. Texas A&M University updated its College Station Campus Master Plan in 2017, which depicts the expansion of their developments along University Drive (FM 60) across from Century Square, bringing the northeastern edge of campus development much closer to Texas Avenue. This expansion provides a key opportunity for the City and the University to work together to ensure that development on either side of Texas Avenue enhances both organizations. With Texas A&M University’s continued growth, the success of the plan will be partially attributed to how efficiently people can get on and off campus. Looking to the opposite boundary, the planning area adjoins the Prairie View Heights neighborhood, which was platted in 1947. It is bounded today by Tarrow Street, Peyton Street, Columbus Street, and Chappel Street. Prairie View Heights is one of the three historically Black neighborhoods in College Station, reflective of the racial segregation patterns of the time. The area has experienced significant gentrification pressures in recent years with the increased demand for student-oriented housing near Texas A&M University. Neighborhood representatives expressed interest in pursuing a Neighborhood Conservation Overlay (NCO) zoning designation in 2011 to support preservation efforts and limit redevelopment pressures but ultimately did not move forward with pursuing the NCO. Changes pursued by this plan should remain sensitive to this context and work to mitigate further gentrification effects on this neighborhood. Outside of the Prairie View Heights neighborhood, many other Eastgate neighborhoods adjoin the planning area, including multiple phases of the College Hills Estates subdivision. Similar careful consideration should be given to potential impacts on these neighborhoods. Page 74 of 206 64CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN A final geographic consideration surrounding the redevelopment area is the proximity to residents in the City of Bryan. The northern boundary is the city limit line, with the City of Bryan beginning on the other side. Along Texas Avenue, the developments continue in a low-density commercial fashion, matching the current development pattern along Texas Avenue in College Station. However, just north of Cooner Street is a low-density residential neighborhood that necessitates consideration. Any changes to the planning area, especially along Cooner Street, may have impacts outside the planning area. Careful consideration of those impacts is needed to ensure the best outcome of the plan. Demographics The planning area has more than doubled in population between 2010 and 2020, increasing from 1,387 to 2,787 people. The estimated population of the area in 2022 is 2,912, making up just over 2% of the total population of College Station. The median age for the area is 22.4, slightly younger than the College Station median age of 23.7. The area population leans slightly more male at 52%. Educational attainment is reflected in the American Community Survey by respondents selecting their highest level of educational attainment. The area has a similar educational attainment for people who are 25 years old or older when compared to the rest of the city. The city and the planning area have 12% of the population with a high school diploma or equivalent, and the planning area has a slightly lower percentage of college graduates at 30% compared to 31% citywide. The planning area has a much higher percentage of people with less than a high school education at 18% compared to the 5% for the city. The area is slightly more diverse than the rest of the city, with the White population being 60.4% compared to the citywide 62.3%. There is a significantly larger Asian population within the area with 29.2% of people identified as Asian, compared to 10.3% of people across the city. Overall, 19% of the people in the planning area identify as Hispanic or Latino, 8.3% of people identify as Black or African American, and 2.6% identify as two or more races. The average household size in the planning area is 3.14 people. The median family income for the area is $38,397, about 70% of the median income for College Station. Average income is also lower than the rest of the city at $55,694, about 66% of the average income across the whole city. Relevant to demographic change within the City of College Station and the planning area will be influenced by continued increases in the student population at Texas A&M University. The proximity to the university campus makes it an attractive area for housing staff and students as identified in existing housing development in the study area. Per Table A.1: Texas A&M University College Station Campus Participation Projections, Texas A&M University’s enrollment is expected to continue increasing through 2035. Source: Enrollment Forecast for Texas Institutions of Higher Education 2021-2035 – January 2021, Texas Higher Education Coordinating Board Table A.1: Texas A&M University College Station Campus Participation Projections Actual 2010 Actual 2015 Actual Prelim 2020 Anticipated 2025 Anticipated 2030 Anticipated 2035 49,129 58,515 65,272 70,279 73,432 77,842 Page 75 of 206 65CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Interpretation of these figures is sometimes complicated by the inclusion of distance education in enrollment figures. According to Table A.2: Texas A&M University College Station Campus Student Headcount, 60,033 students were enrolled on the 20th class day of the spring 2023 semester. Not all students who attend Texas A&M University in non-distance programs live in College Station, but the continued growth of Texas A&M University will likely increase the population of the region, the City of College Station, and the planning area. People who live in the planning area tend to be younger, have lower incomes, and are more diverse when compared to the city overall. These are three indicators that are commonly seen when looking at the student population. Based on these indicators, as well as the proximity to Texas A&M University, it is likely that many people living within the plan boundaries are students. Source: Enrollment Profile, Texas A&M University Office of Academic & Business Performance Analytics Table A.2: Texas A&M University College Station Campus Student Headcount Year 2018-2019 2019-2020 2020-2021 2021-2022 2022-2023 Fall 60,521 60,368 61,503 63,025 64,131 Spring 56,316 56,260 57,765 58,626 60,033 Page 76 of 206 66CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Area Character To assess the existing character of the redevelopment area, staff looked at existing and future land uses, zoning, characteristics of housing and neighborhood centers, and municipal functions, including code enforcement, capital improvements, and permitted development activity. EXISTING LAND USE The planning area is primarily made up of low- to medium-density commercial areas, with some residential throughout the area. Exclusively commercial uses make up 47.3% of the area, with an additional 4.2% of the planning area composed of mixed-use buildings with commercial on ground floors. In addition to the mixed- use residential uses within those structures, 37.8% of the land is being used for an assortment of residential uses. The rest of the area is comprised of public or semi-public uses, including the College Station City Hall, a Bryan Texas Utilities electrical substation, and three religious institutions. FUTURE LAND USE The future land use designations depict the area as a much denser urban area with a greater mix of commercial and residential uses and more housing options. In the Comprehensive Plan Future Land Use & Character Map, the boundary is designated as a Redevelopment Area. The prevailing future land use is the Urban Center land use at 63.7%, which is the most urban form of commercial and residential development. The intent of this land use is a compact and walkable use pattern with multi-story mixed-use structures, a stark contrast from the existing uses within the area. Secondarily, the land uses Neighborhood Center at 12.2% and Mixed Residential at 18.6% comprise a significant portion of the area. These land uses aim to have dense, accessible residential and commercial uses to support the surrounding lower-density residential areas. The Neighborhood Center future land use operates like Urban Center but at a smaller scale to serve as a transition down to lower-density commercial areas and surrounding residential areas. The Mixed Residential future land use serves as a buffer between land uses of different intensities by stepping down in scale and density when approaching existing neighborhoods. Comparing the existing land uses with the future land uses, it becomes clear that planning for redevelopment in this area is a high priority. ZONING Future land uses exist in the Comprehensive Plan to guide policy decisions on properties throughout the city, including changes in zoning. The existing zoning can be evaluated to see how well it aligns with the future land uses envisioned for the area. Commercial zoning districts make up 48.1% of the zoning in the area, with the majority of that being GC General Commercial. Comparatively, 42.9% of the area is zoned for residential uses. Only 9% of the planning area is currently zoned for mixed uses that would be compatible with the urban forms depicted by the future land uses in the area. Zoning changes will need to occur within the planning area to realize the intended future land uses. Page 77 of 206 UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEI S E N H O W E R S T EI S E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T S O U T H C O L L E G E A V E S O U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRExisting Land Use DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS SINGLE- FAMILY RESIDENTIAL DUPLEX RESIDENTIAL MULTI-FAMILY MIXED-USE COMMERCIAL RETAIL COMMERCIAL OFFICE COMMERCIAL OTHER PUBLIC FACILITIES SEMI-PUBLIC TRANSPORTATION, UTILITIES & COMMUNICATION PARKPARK UNIMPROVEDUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEI S E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T S O U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRUNIVERSITY DRMAP A.1 Page 78 of 206 UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEIS E N H O W E R S T EIS E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T S O U T H C O L L E G E A V E S O U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEIS E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T S O U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRUNIVERSITY DRFuture Land Use & Character COLLEGE STATION CITY LIMITS URBAN CENTER NEIGHBORHOOD CENTER GENERAL COMMERCIAL NEIGHBORHOOD COMMERCIAL URBAN RESIDENTIAL MIXED RESIDENTIAL SUBURBAN RESIDENTIAL NEIGHBORHOOD CONSERVATION INSTITUTIONAL/PUBLIC PARKS & GREENWAYS NATURAL & OPEN AREAS TEXAS A&M UNIVERSITY !!!!!REDEVELOPMENT AREAS *NOTE: A COMPREHENSIVE PLAN SHALL NOTCONSTITUTE ZONING REGULATIONS OR ESTABLISH ZONING BOUNDARIES M AP A.2 Page 79 of 206 Zoning CI R - 6 R - 6 GC D GC R - 4 GC PDD D GC GC O CI GS PDD GC GC PDD MH GC D D CI R - 6 GS GC GS GCUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEI S E N H O W E R S T EI S E N H O W E R S T NI M I T Z S T NI M I T Z S TASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T S O U T H C O L L E G E A V E S O U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEI S E N H O W E R S T NI M I T Z S TASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T S O U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRGS GENERAL SUBURBAN D DUPLEX T TO WNHOUSE MF MULTIFAMI LY O OFFICE GC GENERAL COMMERCIAL CI COMMERCIAL INDUSTRIAL CU COLLEGE AND UNIVERSITY PMUD PLANNED MIXEDUS EDEVELOPMENT PDD PLANNED DEVELOPMENT DISTRICT R HIGH DENSITY MULTI FAMILY R MU LTIFAMI LY C LIGHT COMMERCIAL RDD REDEVELOPMENT DISTRICT OV CORRIDOR OVERLAY NG TRANSITIONAL NORTHGATE WPC WOLF PEN CREEK DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS MH MH MH MH MH MH M AP A.3 MH MIDDLE HOUSING Page 80 of 206 70CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN HOUSING CHARACTERISTICS Housing in this area reflects a substantial college student presence. According to the ESRI Living Atlas, almost two-thirds of housing units in the planning area are renter occupied, and that is also reflected in the 71% of housing units that are registered with the City’s Rental Registration program. While primarily rentals, there are still some owner-occupants dotted throughout the area. Of those homes that are owner-occupied, the average home value of $150,575 is less than half of the city’s overall average home value of $363,544. Finally, based on the City’s Housing Conditions survey from 2020 that evaluated the outside maintenance upkeep of living units throughout the city, 84% of homes in the planning area were determined to be in excellent condition. Only 2.5% of the homes in the planning area needed major repairs, being designated as substandard or dilapidated in condition. NEIGHBORHOOD CENTERS The term “third places” describes spaces where people gather outside of their homes and workplaces. These are spaces open to everyone that encourage interactions between people and the community. Many of these third places and community spaces lie just outside the plan boundary, including Thomas Park, Lions Park, and Century Square. Within the planning area, the most significant neighborhood center is the new College Station City Hall, which has been open since December 2021. It provides several meeting spaces available for public reservation to hold community gatherings of all types. Down the street from City Hall is Eastgate Park, a pocket park split across Walton Drive that allows for unprogrammed activities and green space. Finally, there are three religious buildings including the Rohr Chabad Jewish Center at Texas A&M University, the College Station Chinese Bible Church, and the College Hills Baptist Church. Page 81 of 206 71CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN CODE ENFORCEMENT The planning area has had several code enforcement investigations throughout the last 10 years. Most code enforcement investigations resulted in property owner education and voluntary compliance, while a small portion resulted in fines or summons to court. More than half of the issues were solid waste and recycling violations with cans being left out after collection day. This creates conflicts with road users, including cars and bikes, trying to share already narrow roads. The next biggest category was weeds and grass violations at 17.5%. Weeds and grass violations are property maintenance issues where the grass has grown over 12 inches in length. This provides low aesthetic value, can increase issues with pests and vermin, and can hang over into the sidewalk creating access problems for sidewalk users. Finally, the third biggest issue was rental registration violations at 11%, which entails operating a single-family, duplex, triplex, or fourplex rental housing unit without registering with the City’s Rental Registration program or letting existing registration lapse. Compliance with the program helps the City accurately gauge the rental housing stock, keep track of the owner-occupied and renter-occupied homes, and have a local point-of-contact in case issues arise with a rental home. Table A.3: Code Enforcement Cases, 2012-2022 describes the code enforcement cases in the planning area over the past 10 years. Table A.3: Code Enforcement Cases, 2012-2022 Code Violation Type Number of Cases Accumulation of Trash Trash over-flow, typically in yards, causing aesthetic and safety concerns 127 Cans Out After Collection Day Trash or recycling cans still on the curb after trash collection day 1,460 Illegal Signs Signs that are being displayed are prohibited per the City Code 117 Junk Motor Vehicles Dilapidated cars are left in the yard, visible from the street 25 Liquor License Expired Business establishments running with an expired liquor license 17 No More Than Four Unrelated Tenants Violation Permanent occupancy of the structure over the family definition of four unrelated persons 21 Non-Specific Investigation General inquiries/complaints that don’t fit into a specific violation-type 37 Open Storage Storage visible from the street 77 Parking Illegal parking violations 49 Property Maintenance Property is not being maintained, including structural and safety issues 35 Rental Registration A property’s Rental Registration with the City has expired 312 Use Violations Prohibited use type is being used 30 Weeds & Grass A property’s yard is not being properly maintained 495 Total 2,802 Page 82 of 206 UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEI S E N H O W E R S T EI S E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T S O U T H C O L L E G E A V E S O U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEI S E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T S O U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRCODE ENFORCMENT DENSITY* MID HIGHLOW Code Enforcement Case Density DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS Code Enforcement Cases collected by the College Station Code Enforcement Division from 2012-2022 was used to map code issues. These are cases concerning compliance with *Based on the number of crashes within a 250 foot radius codes related to: parking, weeds & grass, health & safety, zoning violations, sanitation & illegal dumping. M AP A.4 Page 83 of 206 73CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN DEVELOPMENT ACTIVITY The City of College Station manages requests and reviews of development proposals and administers development standards through a variety of processes. One development project often necessitates multiple processes, reviews, permits, and inspections before it can be constructed and occupied. An example is a new commercial center that could require a Final Plat, a Development Permit, a Site Plan Review, an Architectural Review, and a Building Permit with inspections. Another example is a new residential subdivision that could require a Zoning Map Amendment, a Preliminary Plan, Final Plats, and Building Permits with inspections. Each project is analyzed for the permits or reviews that will be needed, and in what order those must be obtained. Each permit or review undergoes review by numerous staff in various departments throughout the City. Before the initiation of a project, the City offers pre-application conferences that allow all applicable reviewing departments to clearly communicate the expectations of the project to a future applicant to assist with quicker reviews down the line. The numbers in Table A.4, Development Activity, 2012-2022 show archived and approved project applications over the last 10 years within the plan boundaries. Architectural reviews and site plans were common in the area, reflective of the commercial nature of the planning area. Pre-application conferences were also common in the area, showing interest in development and redevelopment within the area. Table A.4: Development Activity, 2012-2022 Review Type Number of Reviews Abandonments 11 Appeals, Waivers, and Variances 11 Architectural Reviews 34 Commercial Final Plats 4 Development Permits 7 Pre-Application Conferences 28 Preliminary Plan 1 Private Improvements in ROW 1 Residential Final Plats 4 Rezonings 9 Right-of-Way Permits 13 Site Plans 24 Page 84 of 206 Development Activity COMMERCIAL NON-RESIDENTIAL MULTI-FAMILY RESIDENTIAL SINGLE FAMILY RESIDENTIAL DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEI S E N H O W E R S T EI S E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T S O U T H C O L L E G E A V E S O U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEI S E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T S O U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRTE X A S A V E TE X A S A V E TE X A S A V E M AP A.5 Page 85 of 206 75CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN PUBLIC INVESTMENTS Several major capital improvement projects have been pursued in the planning area over the last 10 years. University Drive (FM 60), one of the major thoroughfares through the area, has had pedestrian improvements (completed in FY2020), raised median improvements (completed in FY2020), and a new signal installed at Nimitz Street (completed in FY2021). Texas Avenue, the other major thoroughfare going through the planning area has had pedestrian improvements (completed in FY2014), planter boxes replaced (completed in FY2017), and a new signal installed at Walton Drive (completed in FY2021). University Drive (FM 60) and Texas Avenue are managed by the Texas Department of Transportation (TxDOT), meaning costs for improvements to those roads are shared between the State of Texas and the City. Other roads throughout the planning area are managed locally, meaning they are funded through the Capital Improvement Program or federal and state grants. Several streets were constructed, reconstructed, or rehabilitated, including Cooner Street (completed in FY2013), Nimitz Street (completed in FY2014), Lincoln Avenue (construction begins FY2023), Francis Drive (construction begins FY2023), and Eisenhower Street (construction begins FY2024). In addition to roadway improvements, both the Lincoln Avenue and Francis Drive rehabilitation projects include water, wastewater, and stormwater improvements. Finally, the biggest non-street improvements in the area were the new College Station City Hall building (completed in FY2021) and the Northeast Sanitary Sewer Trunk Line (construction begins FY2024). PUBLIC REALM CONDITIONS Streetscapes within the study area are largely suburban. University Drive (FM 60) between Tarrow Street and Texas Avenue is a primarily commercial thoroughfare, with roadway conditions creating a largely uncomfortable environment for cyclists due to a lack of bike lanes and a lack of comfort for pedestrians due to a lack of separation between the sidewalk and vehicle travel lanes. Tree canopy is infrequent along pedestrian areas or placed behind the sidewalk, resulting in relatively little shade or cooling effect. Parking is primarily located in front of buildings, with a minimal feeling of enclosure due to large setbacks, lack of trees, and the wide street right-of-way. The Northpoint Crossing development attempts to create an improved sense of enclosure with minimal setbacks from the right-of-way, and planting buffers and trees between the travel lanes and sidewalk create a more comfortable pedestrian experience. Pedestrian ramps are also available near this intersection, however, interruptions to sidewalk connections such as bicycles locked to fences and frequent turns may impact access. Page 86 of 206 76CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN A similar streetscape environment exists along Texas Avenue, with large setbacks, front parking areas, and wide right-of-way. However, on the Texas A&M University campus, the presence of a sidewalk that is separated from the right-of-way by a grassy buffer strip and shaded by trees provides a preferred pedestrian alternative. The trees also promote a sense of enclosure along the corridor despite the suburban-style commercial setbacks and the expansive green spaces on the Texas A&M University campus. Near the intersection of Walton Drive and Texas Avenue, a neighborhood commercial environment is evident with primarily one- story commercial buildings with parapet rooflines, a single row of parking separating drive lanes, and some activity such as outdoor displays or dining available on the sidewalk directly in front of businesses. Landscaped islands separating these buildings from Texas Avenue help to reduce road noise and provide greenery, public art, and visual interest. Also in this area is Eastgate Park. This publicly owned park space is unprogrammed, with no amenities or park furnishings aside from the park sign. Between Walton Drive and George Bush Drive East, the pedestrian streetscape experience improves somewhat, with trees and a grassy buffer separating the sidewalk from the Texas Avenue travel lanes, though the sidewalk abuts the frontage drive. There is a public space at the entrance to the new College Station City Hall with a grassy lawn and plaza. A landscaped area along George Bush Drive East between Texas Avenue and Foster Avenue includes some ornamental plantings. This corridor includes painted bike lanes on both sides of the road and sidewalks adjacent to drive lanes. Little public art or wayfinding was identified within the planning area, except for gateway signs to Texas A&M University, the public art installation within the northern Walton Drive/ Texas Avenue island, and gateway elements at City Hall. Page 87 of 206 77CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Economic Indicators As mentioned, the current development pattern of the area is mostly commercial, offering many opportunities for economic growth. According to Table A.5 Estimated Total Sales, Employees, and Businesses, the planning area contains 200 businesses that employ an estimated 1,947 people, averaging approximately 10 employees per business. That is slightly lower than the city’s overall average of 12.5 employees per business. ESRI’s Business Locator report estimates business activity based on address points, including estimates of total sales, number of businesses, and employees. An inspection of Table A.5 Estimated Total Sales, Employees, and Businesses reveals potential estimation issues due to the size of the comparison areas, as well as newer businesses not being accurately captured – for example, sales and employment for the Century Square area are likely substantially higher than the ESRI estimates, based on a comparison to the City’s actual tax revenues. RETAIL, OFFICE, AND HOTEL MARKET Table A.5 Estimated Total Sales, Employees, and Businesses highlights the high sales volume of existing big-box retailers such as Best Buy, Office Depot, and Barnes & Noble in the planning area. Several offices are located within the area, with larger groupings including the Bank of America office building on University Drive (FM 60), 526 University Drive, small-scale offices at 707 Texas Avenue, and some small offices near Eastgate Main. The City of College Station City Hall is also located in the planning area. Six hotels are present within the redevelopment area, including the Hampton Inn, Home2 Suites, and Knights Inn near the Northpoint Crossing development, the Super 8 between Cooner Street and the Bryan city limits, the Embassy Suites at University Drive (FM 60) and Jane Street, and the La Quinta on Live Oak Street. While hotel occupancy tax revenue data was not available for the planning area, the City of College Station levies a 7% hotel occupancy tax. PROPERTY OWNERSHIP Property ownership stability is an important indicator of how frequently new people or businesses are occupying the area. Of the 307 properties, 176, or 57.33%, were owned by the same entity in 2017 and 2022. Of those, 112, or 36.48%, were owned by the same entity in 2012 and 2022. This data shows that almost two-thirds of properties changed hands in the past 10 years, meaning there has been a high turnover in property ownership. Source: ESRI Business Locator Table A.5 Estimated Total Sales, Employees, and Businesses Area 2022 Total Sales Total Employees Total Businesses Northeast Gateway Redevelopment Area $212,061,000 1,947 200 Century Square $18,386,000 336 27 Northgate $79,517,000 1,100 122 Texas Avenue from George Bush Drive to Southwest Pkwy $283,985,000 1,954 126 Page 88 of 206 78CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN SALES AND PROPERTY TAX Another way to track the economic vitality of an area is to assess the amount of taxes that the City collects from the area. The City of College Station currently levies a property tax rate of $0.524613 per $100 valuation and a 1.50% sales tax. Sales tax and property tax revenue performance was estimated using data provided by City staff and appraisal data from the Brazos Central Appraisal District. City staff provided data on sales tax revenues for the redevelopment area as well as nearby commercial areas between January 2018 and September 2022. The comparisons across these areas highlight the relative fiscal productivity of the areas. Generally, more urbanized areas with a higher degree of investment in buildings and improvements as reflected in the Improvement/Land Value Ratio produce higher estimated property tax revenues on a per- acre basis. Though big-box strip areas supporting retailers like H-E-B on Texas Avenue may lead in terms of sales tax revenue, they require a large amount of land and may cost more to service with utilities and infrastructure. Redevelopment and infill in the planning area have the potential to improve the area’s fiscal performance by generating increased property tax and sales tax revenues for the City, offsetting the cost of potential improvements and investments. Source: City of College Station Sales Tax Figures Source: Brazos Central Appraisal District 2022 Certified Tax Roll Table A.6 Sales Tax Revenues Area Estimated Acreage Amount Received October 2021-September 2022 Average Sales Tax/Month Estimated Annual Sales Tax Revenue/Acre Northeast Gateway Redevelopment Area 141.27 $769,017.75 $64,085 $5,444 Century Square 26.6 $485,647 $40,471 $18,257 Northgate 112.11 $490,320 $40,860 $4,374 Texas Avenue from George Bush Drive to Southwest Pkwy 132.03 $6,009,557 $500,796 $22,758 Table A.7 2022 Property Values Area Estimated Acreage Land Value Improvement Value Total Value 2022 Total Value/Acre Northeast Gateway Redevelopment Area 141.27 $107,723,158 $152,327,076 $260,050,234 $1,840,839 Century Square 26.6 $34,434,101 $49,316,979 $83,751,080 $3,148,537 Northgate 112.11 $156,596,002 $376,126,108 $532,722,110 $4,751,497 Texas Avenue from George Bush Drive to Southwest Pkwy 132.03 $71,737,868 $78,064,077 $149,801,945 $1,134,574 Page 89 of 206 79CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Mobility STREETS The Thoroughfare Plan within the City’s Comprehensive Plan details the location and size of existing and future major roadways throughout College Station. The redevelopment area has 10 streets on the Thoroughfare Plan, many of which are already constructed. Texas Avenue and University Drive (FM 60) are constructed as 6-Lane Major Arterials and George Bush Drive East is an existing 4-Lane Minor Arterial. Eisenhower Street is partially constructed as a 2-Lane Major Collector, while Lincoln Avenue is proposed to be improved as a 2-Lane Major Collector. Three existing 2-Lane Minor Collectors are already constructed in the planning area: Foster Avenue, Walton Drive, and Francis Drive. Nimitz Street is proposed to be constructed as a 2-Lane Minor Collector, while Ash Street is proposed to be continued through future redevelopment as a 2-Lane Minor Collector to align with the existing light at Texas Avenue. Source: City of College Station Sales Tax Figures, Brazos Central Appraisal District 2022 Certified Tax Roll Table A.8 Tax Performance per Acre Area Estimated Property Tax Revenues Estimated Property Tax Revenues/Acre Estimated Annual Sales Tax Revenue/Acre Estimated Total Tax Revenues / Acre Northeast Gateway Redevelopment Area $1,364,257 $9,657 $5,444 $15,101 Century Square $0*$0*$18,257 $18,257 Northgate $2,794,729 $24,927 $4,374 $29,301 Texas Avenue from George Bush Drive to Southwest Pkwy $1,364,257 $5,952 $22,758 $28,710 * Century Square is owned by Texas A&M University, a state entity, and thus does not contribute to local property taxes. However, the City does collect sales tax at Century Square. Page 90 of 206 DISTRICT BOUNDARY COLLEGE STATION CITY LIMITSUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEIS E N H O W E R S T EIS E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T SO U T H C O L L E G E A V E SO U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEIS E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T SO U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRExisting Thoroughfare Plan FREEWAY/EXPRESSWAY PROPOSED FREEWAY/EXPRESSWAY LANE MAJOR ARTERIAL PROPOSED LANE MAJOR ARTERIAL LANE MAJOR ARTERIAL PROPOSED LANE MAJOR ARTERIAL LANE MINOR ARTERIAL PROPOSED LANE MINOR ARTERIAL LANE MAJOR COLLECTOR PROPOSED LANE MAJOR COLLECTOR LANE MINOR COLLECTOR PROPOSED LANE MINOR COLLECTOR M AP A.6 Page 91 of 206 81CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN CRASH DATA In the planning area over the last 10 years, 1,167 vehicular crashes have occurred, which is an average of 117 crashes per year. Of those, 913 were minor crashes where no or only minor injuries occurred and 254 were major crashes where major injuries were likely or confirmed. Crashes occurred most frequently at intersections, with 646 in total. Of those, 363 crashes occurred at the intersection of Texas Avenue and University Drive (FM 60), one of the top 10 intersections for crashes in College Station. Improved vehicular safety is a high priority across the city and especially in the area with its high vehicular volumes. Other intersections in the planning area with a high number of crashes include the intersections of Texas Avenue and New Main/Walton Drive, Texas Avenue and Live Oak Street, Texas Avenue and George Bush Drive East, and Texas Avenue and Lincoln Avenue. Of the other crashes in the planning area, 80 were related to private driveway access points, and 441 were not related to an intersection or private driveway. Page 92 of 206 UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEI S E N H O W E R S T EI S E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T S O U T H C O L L E G E A V E S O U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEI S E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T S O U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRCRASH DENSITY* MID HIGHLOW 1 UNIVERSITY DR & TEXAS AVE 2 TEXAS AVE & NEW MAIN DR1 2 3 4 5 3 TEXAS AVE & LIVE OAK ST 4 TEXAS AVE & GEORGE BUSH DR 5 TEXAS AVE & LINCOLN AVE Crash Density DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS TOP 5 INTERSECTIONS WITH CRASHES Crash data collected by the College Station Police Department from 2012- 2022 was used to map tra ic accidents spanning all modes of transportation. *Based on the number of crashes within a 250 foot radius M AP A.7 Page 93 of 206 83CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN BICYCLE AND PEDESTRIAN FACILITIES Bicycle facilities are important infrastructure throughout the city to enable mobility choices for bicyclists navigating into, out of, and throughout the planning area. Within the planning area, there are 3.69 miles of existing bicycle lanes, with an additional 2.66 miles proposed in the Bicycle, Pedestrian, and Greenways Master Plan. For those navigating into the planning area, there are 385 bicycle parking spots provided across 24 commercial locations throughout the planning area, for an average of 16 spots per location. Page 94 of 206 UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEIS E N H O W E R S T EIS E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T SO U T H C O L L E G E A V E SO U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEIS E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T SO U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRUNIVERSITY DRExisting Bicycle Plan DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS BIKE LANE EXISTING BIKE LANE FUNDED BIKE FACILITY PROPOSED BIKE ROUTE EXISTING BIKE ROUTE PROPOSED SHARED-USE PATH EXISTING SHARED-USE PATH FUNDED SHARED-USE PATH PROPOSED GRADE SEPARATION EXISTING GRADE SEPARATION FUNDED GRADE SEPARATION PROPOSED M AP A.8 Page 95 of 206 85CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Strava heatmap data shows that cyclists prefer to cross Texas Avenue at its intersections with New Main Drive/Walton Drive and George Bush Drive East. This highlights that low-comfort conditions along Texas Avenue and University Drive (FM 60) encourage cyclists to utilize alternative routes such as New Main Drive/Walton Drive and George Bush Drive East to reach their destinations. Cycling use is also higher on the shared-use path on the perimeter of Texas A&M University rather than their accompanying street right- of-way. Strava also highlights higher cyclist use on Foster Avenue, which drops off significantly at Lincoln Avenue when Foster Avenue enters the shopping center. A stronger bicycle connection to the east side of Texas Avenue at the Crossing would help cyclists connect more effectively to amenities and housing in this area. Pedestrian facilities offer yet another mobility choice for people living in or wanting to access the planning area. The area has 8.46 miles of existing pedestrian facilities, with an additional 0.97 miles funded. There are 5.43 miles of proposed future pedestrian connections throughout the rest of the planning area. The Strava Map shown here indicates the paths bicyclists take through the planning area. The hotter (more yellow) the path, the more frequently the paths was used. Page 96 of 206 Existing Pedestrian Plan DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS SIDEWALK EXISTING SIDEWALK FUNDED SIDEWALK PROPOSED SHARED-USE PATH EXISTING SHARED-USE PATH FUNDED SHARED-USE PATH PROPOSED GRADE SEPARATION EXISTING GRADE SEPARATION FUNDED GRADE SEPARATION PROPOSED UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRF O S T E R A V E F O S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEI S E N H O W E R S T EI S E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T SO U T H C O L L E G E A V E SO U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRF O S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEI S E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T SO U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRM AP A.9 Page 97 of 206 87CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Strava’s heatmap data for runners and walkers is similar to cyclist data, though it highlights higher volumes along the perimeter of the Texas A&M University campus and the Texas Avenue and University Drive (FM 60) corridors. Volumes are still fairly low within the interior of the redevelopment area. While Strava running/ walking data may reflect recreational user traffic volumes, it also highlights preferred intersection crossings, such as the south and east crossings of Texas Avenue and University Drive (FM 60) that connect to the Texas A&M University perimeter path, and the north side of George Bush Drive East at Texas Avenue. Accordingly, there are key opportunities to improve bicycle and pedestrian connectivity throughout the redevelopment area. The Strava Map shown here indicates the paths pedestrians take through the planning area. The hotter (more yellow) the path, the more frequently the paths was used. Page 98 of 206 88CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN TRANSIT Several bus routes go through the planning area from both major transit providers in the region. First, Brazos Transit District (BTD) operates three routes within the planning area, including the Texas Express, 03 Green, and 04 Maroon. BTD does not currently operate with fixed stops, but all three routes stop in the planning area when requested. BTD is investigating the feasibility of transitioning to a fixed-route bus system, and it will be important to engage them in redevelopment planning discussions within the planning area. Additionally, Texas A&M University Transportation Services runs four bus routes through the planning area, with only the 25 Centerpole having a fixed stop on Lincoln Avenue. The other three, the 04 Gig ‘Em, 12 Reveille, and 22 Excel, drive through the planning area but do not stop. Page 99 of 206 GIG ‘EM GREEN DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS Bus Routes TEXAS A&M UNIVERSITY BUS ROUTES BRAZOS TRANSIT DISTRICT BUS ROUTES UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRTE X A S A V E S TE X A S A V E S HARVEY RDHARVEY RDCOONER STCOONER STPOLO RDPOLO RDNEW MAIN DRNEW MAIN DRWALTON DRWALTON DRFRANCIS DRFRANCIS DRFO S T E R A V E FO S T E R A V E GILCHRIST AVEGILCHRIST AVEMI L N E R D R MI L N E R D R GE O R G E B U S H D R E GE O R G E B U S H D R E HA R R I N G T O N A V E HA R R I N G T O N A V E PU R Y E A R D R PU R Y E A R D RWALTON DRWALTON DRW A L T O N D R W A L T O N D R KYLE AVEKYLE AVEDOMINIK DRDOMINIK DRUNIVERSITY OAKS BLVDUNIVERSITY OAKS BLVDGILCHRIST AVEGILCHRIST AVEBROOKS AVEBROOKS AVEAS H B U R N A V E AS H B U R N A V ELINCOLN AVELINCOLN AVEVASSAR CTVASSAR CTWELLESLEY CTWELLESLEY CTLINCOLN AVELINCOLN AVEEIS E N H O W E R S T EIS E N H O W E R S T NI M I T Z S T NI M I T Z S T AV E N U E A AV E N U E AASH STASH STLIVE OAK STLIVE OAK STPOPLAR STPOPLAR STNI M I T Z S T NI M I T Z S T JA N E S T JA N E S T TE X A S A V E TE X A S A V E TE X A S A V E TE X A S A V E UNIVERSI T Y D R E UNIVERSI T Y D R E PA S L E R S T PA S L E R S T C H U R C H I L L S T C H U R C H I L L S TBANKS STBANKS STPEYTON STPEYTON STTA R R O W S T TA R R O W S T AV E N U E B AV E N U E B AS H B U R N A V E AS H B U R N A V E LINCOLN AVELINCOLN AVEM U N S O N A V E M U N S O N A V E FRANCIS DRFRANCIS DRHOLT STHOLT STTA R R O W TA R R O W S T E S T E ARGUELLO DRARGUELLO DR HENSEL STHENSEL STHENSEL DRHENSEL DRBIZ Z E L L S T BIZ Z E L L S T ROSS STROSS STS P E N C E S T S P E N C E S T IR E L A N D S T IR E L A N D S T SO U T H C O L L E G E A V E SO U T H C O L L E G E A V E BA L L S T BA L L S T U- V R O W U- V R O W W- X R O W W- X R O W UNIVERSITY DRUNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRTE X A S A V E S HARVEY RDCOONER STPOLO RDNEW MAIN DRWALTON DRFRANCIS DRFO S T E R A V E GILCHRIST AVEMI L N E R D R GE O R G E B U S H D R E HA R R I N G T O N A V E PU R Y E A R D RWALTON DRW A L T O N D R KYLE AVEDOMINIK DRUNIVERSITY OAKS BLVDGILCHRIST AVEBROOKS AVEAS H B U R N A V ELINCOLN AVEVASSAR CTWELLESLEY CTLINCOLN AVEEIS E N H O W E R S T NI M I T Z S T AV E N U E AASH STLIVE OAK STPOPLAR STNI M I T Z S T JA N E S T TE X A S A V E TE X A S A V E UNIVERSI T Y D R E PA S L E R S T C H U R C H I L L S TBANKS STPEYTON STTA R R O W S T AV E N U E B AS H B U R N A V E LINCOLN AVEM U N S O N A V E FRANCIS DRHOLT STTA R R O W S T E ARGUELLO DR HENSEL STHENSEL DRBIZ Z E L L S T ROSS STS P E N C E S T IR E L A N D S T SO U T H C O L L E G E A V E BA L L S T U- V R O W W- X R O W UNIVERSITY DRREVEILLE EXCEL MAROON TEXAS EXPRESS M AP A.10 Page 100 of 206 90CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Conclusion Analyzing the existing conditions of the redevelopment area provides context and serves as the baseline for the plan creation process. Based on the collected data, some important conclusions can be drawn. First, the data shows that the area is primed for redevelopment. The Comprehensive Plan Future Land Use & Character Map reflects significant changes in uses from what is on the ground today, properties have been frequently changing hands, major infrastructure investments have been made from the public and private sides, and there has been an increase in density in recent developments. Second, the current population of the planning area is younger when compared to the rest of the city. While not all, a high percentage of people living in the plan boundaries likely attend classes or work at Texas A&M University due to its proximity, and that is unlikely to change. Additionally, the plan for redevelopment to a more urban form is expected to draw in people who are interested in living in a more walkable street pattern, including students, young families, and professionals. The plan should reflect this fact in its goals and actions. Finally, investments will need to be made by the City to fully realize the goals of an urban redevelopment plan. Vehicular crashes and mobility safety remain an issue along Texas Avenue and University Drive (FM 60), transit is not common in the planning area, and utility constraints are likely to force redevelopment to be phased over multiple years to align with substantial increases in utility demands from mixed-use projects. Each of these investments, whether public or privately initiated, will need to be carefully considered and coordinated. The resulting plan should reflect and address these conclusions in its implementation. Page 101 of 206 91CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN APPENDIX B: PUBLIC ENGAGEMENT SUMMARY Public participation and input are critical to any planning effort. The knowledge and experience of residents help City staff understand the concerns of the community and adjust the plan accordingly. The City of College Station places a high priority on receiving and responding to resident feedback; to that end, City staff offered numerous engagement opportunities in various formats to empower residents to participate and have their voices heard. The following describes those opportunities and summarizes the public feedback. Page 102 of 206 92CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN WORKING GROUP MEETING – NOVEMBER 16, 2022 After compiling the existing conditions data, the Working Group held its kick-off meeting to discuss the project, set expectations for the December 5 and December 7 public meetings, and begin discussions around project names and branding. PROPERTY & BUSINESS OWNER MEETING – DECEMBER 5, 2022 Before this meeting, staff mailed fliers to property owners within the planning area with details for this meeting and the January 30 property owner meeting. This meeting centered on defining the scope of the project, as well as a naming and branding discussion. AREA-WIDE MEETING – DECEMBER 7, 2022 Before this meeting, staff mailed fliers to residents within the planning area with details for this meeting and the February 1 area-wide meeting. Similar to the property owner meeting on December 5, this meeting centered on defining the scope of the project, as well as a naming and branding discussion. WORKING GROUP MEETING – DECEMBER 12, 2022 The Working Group then met to discuss the public input from the December 5 and 7 meetings. During this meeting and based on the feedback from the previous meetings, the Working Group decided to split the planning area at Lincoln Avenue and plan for the two subareas separately. The discussion also included the upcoming meetings and the rest of the plan timeline. VIRTUAL ENGAGEMENT SITE – JANUARY TO MAY 2023 In addition to the in-person meetings, staff offered numerous opportunities to provide feedback throughout the planning effort. The site launched with more information on the timeline of the planning effort, ideas on goals from the first phase meetings, and a map where individuals could provide ideas, things they liked, and things they wanted to see changed. The virtual engagement site also hosted the scenario modeling activities prior to the April 26 meeting. ON-CAMPUS MEETING – JANUARY 25, 2023 To offer members of the Texas A&M University community opportunities to engage with the planning effort, staff held two meetings in the Memorial Student Center. This was the first of those meetings where the campus community provided feedback on the branding options and ideas for plan actions. Page 103 of 206 93CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN PROPERTY & BUSINESS OWNER MEETING – JANUARY 30, 2023 Staff held a second meeting with property owners to discuss their ideas on the plan goals and begin brainstorming plan actions. The goal was to bring the ideas to the February 1 meeting for broader community feedback. However, this meeting and the meeting on February 1 were impacted by an unseasonal cold snap and were scarcely attended. Staff instead gathered feedback from those in attendance and began to develop the virtual area-wide meeting that was held on February 21. AREA-WIDE MEETING – FEBRUARY 1, 2023 Due to the cold snap, the meeting was not well attended. However, staff incorporated the activities from this meeting into the virtual area-wide meeting on February 21. WORKING GROUP MEETING – FEBRUARY 7, 2023 The Working Group met to discuss the January 30 and February 1 meetings and some of the proposed plan actions. The group finalized the subarea goals, which were then added to the project website for broader community feedback. ON-CAMPUS MEETING – FEBRUARY 13, 2023 The second and final meeting in the Memorial Student Center, this meeting focused on brainstorming for plan actions and reflecting on the campus community vision for the planning area. VIRTUAL AREA-WIDE MEETING – FEBRUARY 21, 2023 The virtual area-wide meeting focused on gathering feedback on the plan goals and actions from people who may not have been able to make it to any of the previous meetings. Incorporating the feedback from this and all of the previous meetings, staff began working with Asakura Robinson on the scenario modeling for the April 26 area- wide meetings. WORKING GROUP MEETING – MARCH 28, 2023 The Working Group met to discuss and suggest changes to the different scenarios that were offered for public comment on the website and at the April 26 area-wide meeting. City staff and Asakura Robinson collaborated on the modifications to the scenarios. AREA-WIDE MEETING – APRIL 26, 2023 This area-wide meeting empowered residents to view and provide comments on three development scenarios for the planning area. The feedback from this meeting and internal City discussions were compiled into a preferred scenario. Page 104 of 206 94CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN WORKING GROUP MEETING – MAY 23, 2023 In the penultimate meeting of the Working Group, the conversation focused on the results of the scenario exercise and helping staff identify a preferred scenario. Following this meeting, City staff and Asakura Robinson collated the feedback from the previous meetings into a draft of the Northeast Gateway Redevelopment Plan. WORKING GROUP MEETING – AUGUST 8, 2023 The Working Group met before the Northeast Gateway Redevelopment Plan was finalized to discuss the plan actions and help finalize the plan narrative. This feedback was incorporated into the plan before the final area-wide meeting. AREA-WIDE MEETING – AUGUST 28, 2023 After finishing the Northeast Gateway Redevelopment Plan, City staff organized one final area-wide meeting to ensure the plan matched the vision of the community and gather any final edits before bringing the plan forward for adoption. Page 105 of 206 95CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN APPENDIX C: SCENARIO MODELING In preparation for the April 26 meeting, Asakura Robinson developed three alternative buildout scenarios within the Northeast Gateway Redevelopment Area: a low redevelopment scenario called Big Box Retrofit, a medium redevelopment scenario called High-Quality Housing, and a high redevelopment scenario called Urban Village. These scenarios helped visualize and quantify the impacts of potential redevelopment within the planning area. These three illustrative scenarios were used at the April 26 area-wide meeting and on the virtual engagement website to shape the conversation around a preferred redevelopment scenario. The scenario boards used during the April 26 meeting are available at the end of this chapter in Graphic C.1: Preferred Scenario, Graphic C.2: Big Box Retrofit, Graphic C.3: High-Quality Housing, and Graphic C.4: Urban Village. The scenarios were scoped to highlight a varied mix of land uses and development intensities. Based on community feedback, City staff and Asakura Robinson developed a preferred scenario that was incorporated into the final plan recommendations, drawing on elements from the three original scenarios. Page 106 of 206 96CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Process & Methods Asakura Robinson outlined three scenarios that were reviewed by City staff. Following initial feedback, the team held an internal charette and developed strategies for connectivity, building footprints, heights, and use. Working with City staff, the team refined these scenarios to develop building types. The building types formed the basis of the model in Urban Footprint, an interactive online mapping and analysis tool. Urban Footprint’s base parcel dataset utilizes CoreLogic’s proprietary datasets to estimate the mix and amount of land and building uses, residents, and employment on each parcel. Asakura Robinson staff conducted an initial quality control review of the base parcel dataset to correct discrepancies between this product and known development within College Station. Parcel attributes were modified to reflect actual development, with the results of Urban Footprint’s base scenario available in Table C.1: Base Conditions Comparison. Urban Footprint’s assumptions utilize publicly available US Census data as well as per-unit assumptions. The City’s existing conditions data notes an average household size of 3.14, which is higher than Urban Footprint’s residents-per-unit assumptions for single-family and multi-family units. A review of Census 2020 block level information and unit counts showed an approximate household size of 2.58 for the Northpoint Crossing development, which is likely more reflective of the mix of unit types in new multifamily development. New single-family and middle housing developments, therefore, used the 3.14 persons per household multiplier in Urban Footprint, while multifamily developments used the 2.58 persons per household multiplier. Although corrected parcels included the Northpoint Crossing development and infill shared housing, the base scenario’s estimate of population is likely low due to the Urban Footprint platform’s use of multipliers. Conversely, Urban Footprint’s base scenario estimate for employment is likely higher than the estimate in the existing conditions data sourced from ESRI Business Analyst due to existing vacancies within the study area, such as the former Albertson’s site within the University Plaza shopping center, vacant commercial space near Live Oak Street, and the ground-floor retail at Northpoint Crossing. ESRI Business Analyst utilizes Data Axle business-level data to identify business locations, sales, and employee counts, while Urban Footprint uses the US Census Longitudinal Employer-Household Dynamics (LEHD) Origin- Destination Employment Statistics (LODES) dataset (2018) disaggregated to the parcel level using land use designations. Asakura Robinson also identified the larger parking areas within the planning area and reallocated the population/employment attributes from those areas to their respective buildings. This is an important step for infill development scenarios that preserve existing buildings while new buildings are constructed in excess parking areas. As the base scenario figures are primarily used to calculate and contextualize the increment of new development when compared to existing conditions, the estimates were deemed appropriate to proceed. Table C.1: Base Conditions Comparison Population Dwelling Units Employment Improvement Square Footage Existing Conditions Data (Appendix A)2,912 1,291 1,954 2,483,791 Urban Footprint Base Scenario 2,686 1,221 2,467 2,439,182 Page 107 of 206 97CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN BUILDING & PLACE TYPE ASSUMPTIONS Asakura Robinson reviewed Urban Footprint’s library of land use paints (building types) for appropriateness and consistency with the building types identified in each scenario and developed new building types to respond to desired local conditions. The new building types reflected known developments within the College Station area and Texas as a whole, aiming to capture site design considerations including increased setbacks and parking needs that were not well-represented in Urban Footprint’s standard paints. The final building types used across the scenarios are identified in Table C.2: Building Type Assumptions. The land use paint best reflecting the development shown in the scenario was applied to parcels in Urban Footprint to approximate new development. Urban Footprint calculated a standardized set of buildout metrics for each scenario which were then exported and processed. For a 100% redevelopment scenario, blended place types were created to approximate the overall composition of the Urban Center and Neighborhood Center land use types. Public parcels and parks were excluded from the 100% redevelopment scenario. The results of this aggregation are identified in Table C.3: Place Type Assumptions. 3D VISUALIZATION & GRAPHICS PRODUCTION Asakura Robinson recreated the sketched scenarios in the Rhino 3D graphics and computer-aided design (CAD) software to visualize the heights and massing within the context of the study area. Graphic callouts and explanations were inserted in Adobe Illustrator and Adobe InDesign to support clear communication for public understanding and interpretation during the public meeting. Page 108 of 206 Table C.2: Building Type Assumptions Building Type Name Description Floor Area Ratio Residential Density Population Density Employment Density Average Gross Floor Area per Employee Residential Square Footage (%)Commercial Square Footage (%) 3-4 Story CommercialRetail and Office A mix of ground floor retail and services with office uses.1.281 0 0 148.221 340.852 0%100% 3-4 Story Vertical Mixed Use A mix of ground floor retail and services with residential.1.529 46.704 84.109 32.306 528.825 71.9%28.1% 6-10 Story Vertical Mixed Use 6-8 story apartment building with a garage, some ground- floor retail.3.279 117.748 210.299 61.263 488.854 78.8%21.2% 8-10 Story Multifamily Mid-rise multifamily with ground-floor retail.4.564 138.366 247.122 83.639 454.183 77.1%22.9% Low-Rise Strip Retail 1-story restaurant and retail with a front row of parking.0.390 0 0 23.901 584.854 0%100% Retail Green/Hub Central green space with low-rise restaurants flanking the green.0.433 0 0 41.82 429.427 0%100% Standard Podium Multifamily 3-4 story multifamily.1.954 65.257 116.549 7.293 260.265 95.6%4.4% Urban Podium Multifamily 3-6 story multifamily with some mixed use.3.239 133.813 238.99 16.969 260.265 94.9%5.2% Suburban Townhome Townhouse density with increased setbacks and larger unit sizes.0.770 20.173 59.544 0 N/A 100%0% Urban Townhome Live/Work Townhouse with minimal setbacks, greater heights, small unit size, and workspaces on the ground floor.1.368 35.457 104.654 18.167 168 92.2%7.8% Table C.3: Place Type Assumptions Place Type Name Description Floor Area Ratio Residential Density Population Density Employment Density Average Gross Floor Area per Employee Residential Square Footage (%) Commercial Square Footage (%) Urban Center 18% urban podium multifamily, 18% standard podium multifamily, 15% low-rise strip retail, 14% 3-4 story commercial retail and office, 12.5% 8-10 story multifamily, 12.5% 6-8 story multifamily, 5% retail green/hub, 5% parking structure 2.181 66.49 du/ac 118.751 pop/ac 48.385 emp/ac 396.5 53.8%46.2% Neighborhood Center 20% 3-4 Story Vertical Mixed Use, 10% Low-Rise Strip Retail, 60% Suburban Townhome, 10% Urban Townhome Live/Work 0.943 24.99 du/ac 63.014 pop/ac 10.668 emp/ac 181.1 83.6%16.4% Mixed Residential 90% Suburban Townhome, 10% Urban Townhome Live/Work 0.829 21.702 du/ac 64.055 du/ac 1.817 emp/ac 16.8 99.2%0.8% Page 109 of 206 99CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Modeling Results The Urban Footprint Summary Statistics in Table C.4: Summary Statistics for Scenarios include all initial outputs from Urban Footprint. Because parcel-specific base values were not verified, specific square footage estimates are not guaranteed to be accurate. However, the differences between the base scenario values and the individual scenario outcomes can highlight the relative scale of potential changes between each scenario. SUMMARY STATISTICS Source: Urban Footprint Source: Urban Footprint ESTIMATED FLOOR-AREA RATIO & FISCAL IMPACT As Urban Footprint does not have modules to calculate the planning area’s floor-area ratio or fiscal impact, selected estimates were processed in spreadsheet software. The area-wide floor-area ratio figures in Table C.5: Estimated Floor-Area Ratio were calculated for each scenario to approximate their relative levels of building area and parcel coverage. Table C.4: Summary Statistics for Scenarios Scenario Population Dwelling Units Jobs Residential Square Footage Non-Residential Square Footage Base Scenario 2,686 1,221 2,467 1.25M 1.19M Scenario 1 – Low 5,041 2,188 3,862 2.25M 1.71M Scenario 2 –Medium 9,038 3,888 4,058 3.87M 1.77M Scenario 3 – High 13,420 5,675 5,152 5.52M 2.06M Preferred Scenario 11,373 4,873 3,795 4.74M 1.70M Preferred Scenario (100% buildout)17,760 7,351 5,078 7.06M 2.196M Table C.5: Estimated Floor-Area Ratio Scenario Floor Area (acres)Parcel Area (acres)Floor-Area Ratio Base Scenario 57.02 152.46 0.37 Scenario 1 – Low 90.88 152.46 0.60 Scenario 2 –Medium 129.58 152.46 0.85 Scenario 3 – High 173.92 152.46 1.14 Preferred Scenario 148.04 152.46 0.97 Preferred Scenario (100% buildout)212.58 152.46 1.39 Page 110 of 206 100CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Improvement values are the primary driver of increased real property values through redevelopment and generally vary depending on construction type and improvement size. The 2022 certified tax roll appraisal data from the Brazos Central Appraisal District was gathered for the planning area as well as nearby commercial districts in College Station and are listed in Table C.6: 2022 Land and Improvement Values. Source: Brazos Central Appraisal District 2022 Certified Tax Roll Table C.6: 2022 Land and Improvement Values Study Areas Acreage Appraised Land Value Appraised Land Value per Acre Livable Square Footage Appraised Improvement Value Improvement Value Per Square foot Century Square 26.6 $34,434,101 $1,294,515 437,911 $49,316,979 $113/SF Northgate 112.11 $156,596,002 $1,396,723 3,760,879 $376,126,108 $100/SF Texas Avenue (from George Bush Dr. E to Southwest Pkwy) 132.03 $71,737,868 $543,330 1,412,544 $78,064,077 $55/SF Northeast Gateway Redevelopment Area 152.46 $124,893,968 $819,211 2,483,791 $253,836,266 $102/SF Page 111 of 206 101CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN The project team chose two scenarios to analyze possible outcomes for improved square footage valuation: $100/SF and $125/SF. The $100/SF scenario in Table C.7: Estimated Property Tax Revenues - $100/ SF Scenario is similar to the valuation already seen within the planning area, and the $125/SF scenario in Table C.8: Estimated Property Tax Revenues - $125/SF Scenario is an approximate average of the valuation of newly constructed mixed-use building types across College Station. Newer improvements typically have higher values per square foot than older improvements, which have depreciated over time. Mixed-use building types, particularly those over six or seven stories, also include more costly steel, masonry, and concrete construction materials instead of wood framing. Source: Urban Footprint, Brazos Central Appraisal District 2022 Certified Tax Roll Source: Urban Footprint, Brazos Central Appraisal District 2022 Certified Tax Roll Table C.7: Estimated Property Tax Revenues - $100/SF Scenario Scenario Estimated Added Square Footage Value of Estimated Added Square Footage Additional Property Tax Revenue ($0.524613/$100 value) Estimated Property Tax Values (Land and Improvement) Estimated Total Property Tax Revenue Base Scenario ---$1,986,868 $1,986,868 Scenario 1 – Low 1,475,127 $147,512,745 $773,871 $1,986,868 $2,760,739 Scenario 2 –Medium 3,160,887 $316,088,661 $1,658,242 $1,986,868 $3,645,110 Scenario 3 – High 5,092,329 $509,232,859 $2,671,502 $1,986,868 $4,658,370 Preferred Scenario 3,965,045 $396,504,550 $2,080,114 $1,986,868 $4,066,982 Preferred Scenario(100% buildout)6,776,297 $677,629,679 $3,554,933 $1,986,868 $5,541,801 Table C.8: Estimated Property Tax Revenues - $125/SF Scenario Scenario Estimated Added Square Footage Value of Estimated Added Square Footage Additional Property Tax Revenue ($0.524613/$100 value) Estimated Property Tax Values (Land and Improvement) Estimated Total Property Tax Revenue Base Scenario ---$1,986,868 $1,986,868 Scenario 1 – Low 1,475,127 $184,390,932 $967,339 $1,986,868 $2,954,207 Scenario 2 –Medium 3,160,887 $395,110,826 $2,072,803 $1,986,868 $4,059,671 Scenario 3 – High 5,092,329 $636,541,074 $3,339,377 $1,986,868 $5,326,245 Preferred Scenario 3,965,045 $495,630,687 $2,600,143 $1,986,868 $4,587,011 Preferred Scenario(100% buildout)6,776,297 $847,037,098 $4,443,667 $1,986,868 $6,430,535 Page 112 of 206 102CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Sales tax revenue per square foot was estimated using Urban Footprint’s estimate of additional retail square footage within the planning area and sales tax information provided by the City, which was estimated to be $0.937/SF based on existing revenues ($769,018 in FY2022) and square footage (821,110). As this estimate includes vacant retail spaces that are not currently producing sales tax revenues, increased occupancy or sales will cause this multiplier to increase. Thus, additional sales tax revenues in Table C.9: Estimated Sales Tax Revenues should be regarded as a conservative estimate. Source: City of College Station Sales Tax Figures Source: Urban Footprint, Brazos Central Appraisal District 2022 Certified Tax Roll, City of College Station Sales Tax Figures Sales tax revenue performance from Table C.9: Estimated Sales Tax Revenues were added to the results from Table C.7: Estimated Property Tax Revenues - $100/SF Scenario and Table C.8: Estimated Property Tax Revenues - $125/SF Scenario to show a potential range of outcomes based on improvements within the planning area. Those outcomes are available in Table C.10: Estimated Total Tax Revenues Per Acre - $100/SF Scenario and Table C.11: Estimated Total Tax Revenues Per Acre - $125/ SF Scenario. Table C.9: Estimated Sales Tax Revenues Scenario Added Retail Square Footage Estimated Additional Sales Tax Revenue ($0.937/SF of retail space)Estimated Sales Tax Revenue Base Scenario -$0 $769,018 Scenario 1 – Low 188,834 $176,938 $945,955 Scenario 2 –Medium 302,104 $283,072 $1,052,090 Scenario 3 – High 401,819 $376,504 $1,145,522 Preferred Scenario 343,578 $321,933 $1,090,951 Preferred Scenario(100% buildout)725,736 $680,015 $1,449,033 Table C.10: Estimated Total Tax Revenues Per Acre - $100/SF Scenario Scenario Estimated Total Property Tax Revenue Estimated Sales Tax Revenue Estimated Total Tax Revenue Total Acreage Estimated Tax Revenues per Acre Base Scenario $1,986,868 $769,018 $2,755,886 152.46 $18,076 Scenario 1 – Low $2,760,739 $945,955 $3,706,694 152.46 $24,313 Scenario 2 –Medium $3,645,110 $1,052,090 $4,697,200 152.46 $30,809 Scenario 3 – High $4,658,370 $1,145,522 $5,803,892 152.46 $30,809 Preferred Scenario $4,066,982 $1,090,951 $5,157,933 152.46 $33,831 Preferred Scenario(100% buildout)$5,541,801 $1,449,033 $6,990,834 152.46 $45,854 Page 113 of 206 103CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Source: Urban Footprint, Brazos Central Appraisal District 2022 Certified Tax Roll, City of College Station Sales Tax Figures Finally, parcel-level estimates were also developed to estimate utility and transportation demands within the area. Utility demands, expressed as land use equivalents, are derived using estimated water and wastewater demands based on building types and square footage. Vehicle trips per day were generated using Urban Footprint’s built-in transportation modeling capabilities with ITE trip generation calculations. These estimates were developed without professional engineering guidance, and future studies should assess existing capacity and refine demand projections. Source: Urban Footprint Table C.11: Estimated Total Tax Revenues Per Acre - $125/SF Scenario Scenario Estimated Total Property Tax Revenue Estimated Sales Tax Revenue Estimated Total Tax Revenue Total Acreage Estimated Tax Revenues per Acre Base Scenario $1,986,868 $769,018 $2,755,886 152.46 $18,076 Scenario 1 – Low $2,954,207 $945,955 $3,900,162 152.46 $25,582 Scenario 2 –Medium $4,059,671 $1,052,090 $5,111,761 152.46 $33,529 Scenario 3 – High $5,326,245 $1,145,522 $6,471,767 152.46 $42,449 Preferred Scenario $4,587,011 $1,090,951 $5,677,962 152.46 $37,242 Preferred Scenario(100% buildout)$6,430,535 $1,449,033 $7,879,568 152.46 $51,683 Table C.12: Utility and Transportation Model Outcomes Scenario Land Use Equivalents Vehicle Trips Per Day (ITE) Base Scenario 2,614 57,473 Scenario 1 – Low 3,680 72,650 Scenario 2 – Medium 5,142 85,473 Scenario 3 – High 6,900 100,886 Preferred Scenario 6,038 90,977 Preferred Scenario(100% buildout)8,945 122,492 Page 114 of 206 CREATE A SECOND BICYCLE CROSSING AT UNIVERSITY DRIVE IMPROVED BICYCLE FACILITIES ON NIMITZ STREET CAN HELP CYCLISTS CROSS SAFELY AT THE NIMITZ/UNIVERSITY INTERSECTION SITE DENSE HOUSING FOR ACCESS AND AMENITIES RESIDENTIAL BUILDINGS WITH GROUND-FLOOR RETAIL OR AMENITY SPACES CAN ACTIVATE FOOT TRAFFIC AND SERVE RESIDENTS AND WORKERS EXTEND FOSTER AVENUE AND ASH STREET CREATE AN URBAN STREET GRID WITH IMPROVED BICYCLE AND PEDESTRIAN FACILITIES REIMAGINE EASTGATE PARK AS COLLEGE STATION’S “FRONT PORCH” PLAZA IMPROVE PUBLIC SPACE CONDITIONS TO CREATE A VIBRANT SPACE FOR EVENTS AND GATHERINGS BUILD UP ON UNIVERSITY DRIVE PRIORTIZING TALLER FLEXIBLE COMMERCIAL/OFFICE SPACE ON UNIVERSITY DRIVE LEAVES ROOM FOR SMALL BUSINESSES TO GROW IN COLLEGE STATION CONNECT TO BILLIE MADELEY PARK REIMAGINE EXISTING STORMWATER MANAGEMENT FACILITY AND PROVIDE A TRAIL CONNECTION TO BILLIE MADELEY PARK UNIVERSITY DRIVE COONER STREET FOSTER AVENUE CITY HALL NORTHPOINT CROSSING TEXAS AVENUE LIVE OAK STREET EASTGATE ENTRANCE TO TEXAS A&M CAMPUS GRADE-SEPARATED BICYCLE & PEDESTRIAN CROSSING GRADE-SEPARATED BICYCLE & PEDESTRIAN CROSSING LEGEND COMMERCIAL (LOW RISE)MULTIFAMILY RESIDENTIAL OFFICE OPENSPACE/GREENSPACE STRUCTURED PARKING STREET COMMERCIAL/RETAIL (STOREFRONT)MIDDLE HOUSING AND TOWNHOMES HOTEL SURFACE PARKING PRIORITY IMPROVEMENT DISTRICT BOUNDARY +1,841 JOBS NEW EMPLOYMENT OPPORTUNITIES + 3,583 DWELLINGS NEW RESIDENTIAL UNITS + 343,578 SQ. FT. NEW RETAIL SPACE + 174,125 SQ. FT. NEW OFFICE SPACE AT A GLANCE:PREFERREDSCENARIO Page 115 of 206 SCENARIO 1 “BIG BOX RETROFIT” UNIVERSITY DRIVE COONER STREET FOSTER AVENUE CITY HALL NORTHPOINT CROSSING TEXAS AVENUE LIVE OAK STREET EASTGATE ENTRANCE TO TEXAS A&M CAMPUS GRADE-SEPARATED BICYCLE & PEDESTRIAN CROSSING GRADE-SEPARATED BICYCLE & PEDESTRIAN CROSSING LEGEND COMMERCIAL (LOW RISE)MULTIFAMILY RESIDENTIAL OFFICE OPENSPACE/GREENSPACE STRUCTURED PARKING STREET COMMERCIAL/RETAIL (STOREFRONT)MIDDLE HOUSING AND TOWNHOMES HOTEL SURFACE PARKING CONNECTIVITY IMPROVEMENT DISTRICT BOUNDARY CONNECT TO BILLIE MADELEY PARK REIMAGINE EXISTING STORMWATER MANAGEMENT FACILITY AND PROVIDE A TRAIL CONNECTION TO BILLIE MADELEY PARK ENHANCE EXISTING SHOPPING CENTERS LARGE RETAILERS AND ENTERTAINMENT FACILITIES REMAIN AT THE CORE OF THIS SCENARIO. RIGHTSIZING PARKING REQUIREMENTS LEAVES ROOM FOR NEW COMMERCIAL AND OFFICE INFILL REDEVELOPMENT. EXTEND FOSTER AVENUE COMPLETE A SECOND EAST-WEST CONNECTION AS A SECOND MAIN STREET WITH GATHERING SPACES RETROFIT RETAIL WITH PHASED DEVELOPMENT PROMOTE INFILL DEVELOPMENT THAT ADDRESSES EXISTING “MEGABLOCKS” AND RESTORES THE CITY STREET NETWORK WHILE SUPPORTING EXISTING BUSINESSES SUPPORT HISTORIC EASTGATE MAINTAIN EXISTING SMALL RETAIL AND OFFICE SPACES WHILE ENHANCING GREEN SPACE AND PEDESTRIAN ACCESS. SUPPORT BUSINESS WITH NEARBY EMPLOYMENT OPPORTUNITIES +1,908 JOBS NEW EMPLOYMENT OPPORTUNITIES + 897 DWELLINGS NEW RESIDENTIAL UNITS + 188,834 SQ. FT. NEW RETAIL SPACE + 326,614 SQ. FT. NEW OFFICE SPACE AT A GLANCE: Page 116 of 206 SCENARIO 2 “HIGH-QUALITY HOUSING” UNIVERSITY DRIVE COONER STREET FOSTER AVENUE CITY HALL NORTHPOINT CROSSING TEXAS AVENUE LIVE OAK STREET EASTGATE ENTRANCE TO TEXAS A&M CAMPUS GRADE-SEPARATED BICYCLE & PEDESTRIAN CROSSING GRADE-SEPARATED BICYCLE & PEDESTRIAN CROSSING LEGEND COMMERCIAL (LOW RISE)MULTIFAMILY RESIDENTIAL OFFICE OPENSPACE/GREENSPACE STRUCTURED PARKING STREET COMMERCIAL/RETAIL (STOREFRONT)MIDDLE HOUSING AND TOWNHOMES HOTEL SURFACE PARKING CONNECTIVITY IMPROVEMENT DISTRICT BOUNDARY URBAN TRAIL UTILIZING A “BACK PORCH APPROACH”, THIS SCENARIO PROPOSES A PEDESTRIAN AND BIKE NETWORK TO BETTER CONNECT RESIDENTS BUILD UP ON UNIVERSITY DRIVE PRIORTIZING TALLER FLEXIBLE COMMERCIAL/ OFFICE SPACE ON UNIVERSITY DRIVE LEAVES ROOM FOR SMALL BUSINESSES TO GROW IN COLLEGE STATION ENCOURAGE MIDDLE HOUSING INFILL MIDDLE RESIDENTIAL DEVELOPMENT INCLUDING TOWNHOMES AND MULTIPLEXES CAN ALLOW FOR GRADUAL GROWTH AND REDEVELOPMENT OVER TIME SITE DENSE HOUSING FOR ACCESS AND AMENITIES RESIDENTIAL BUILDINGS WITH GROUND-FLOOR RETAIL OR AMENITY SPACES CAN ACTIVATE FOOT TRAFFIC AND SERVE RESIDENTS AND WORKERS EXTEND FOSTER AVENUE AS A LIVING SHARED STREET ‘WOONERFS” - A DUTCH TERM FOR LIVING STREETS - CREATE VIBRANT SHARED SPACES FOR ALL TRANSPORTATION MODES +2,104 JOBS NEW EMPLOYMENT OPPORTUNITIES + 2,597 DWELLINGS NEW RESIDENTIAL UNITS + 302,104 SQ. FT. NEW RETAIL SPACE + 283,875 SQ. FT. NEW OFFICE SPACE AT A GLANCE: Page 117 of 206 SCENARIO 3 “URBAN VILLAGE” UNIVERSITY DRIVE COONER STREET FOSTER AVENUE CITY HALL NORTHPOINT CROSSING TEXAS AVENUE LIVE OAK STREET EASTGATE ENTRANCE TO TEXAS A&M CAMPUS GRADE-SEPARATED BICYCLE & PEDESTRIAN CROSSING GRADE-SEPARATED BICYCLE & PEDESTRIAN CROSSING LEGEND COMMERCIAL (LOW RISE)MULTIFAMILY RESIDENTIAL OFFICE OPENSPACE/GREENSPACE STRUCTURED PARKING STREET COMMERCIAL/RETAIL (STOREFRONT)MIDDLE HOUSING AND TOWNHOMES HOTEL SURFACE PARKING CONNECTIVITY IMPROVEMENT DISTRICT BOUNDARY CREATE A NEW GATEWAY TO TEXAS A&M DENSE VERTICAL DEVELOPMENT WILL ALSO SUPPORT GROUND FLOOR RETAIL THAT PROVIDES AN “URBAN VILLAGE” ATMOSPHERE AT THIS IMPORTANT GATEWAY TO CAMPUS RETHINK SHOPPING CENTERS AS MARKET STREETS PEDESTRIAN ORIENTED RETAIL INTEGRATED WITH HIGH QUALITY RESIDENTIAL DEVELOPMENT CREATE NEW GREEN GATHERING SPACES PRIORITIZING HIGH-DENSITY DEVELOPMENT PROVIDES NEW OPPORTUNITIES FOR WALKABLE, VIBRANT URBAN GREEN SPACES EMBEDDED IN THE NEIGHBORHOOD ENCOURAGE MIDDLE HOUSING INFILL MIDDLE RESIDENTIAL DEVELOPMENT INCLUDING TOWNHOUSES AND MULTIPLEXES CAN ALLOW FOR GRADUAL GROWTH AND REDEVELOPMENT OVER TIME PURSUE PUBLIC-PRIVATE PARTNERSHIPS REDEVELOPING THE OLD CITY HALL SITE TO SUPPORT ECONOMIC DEVELOPMENT PRIOR- ITIES WOULD SUPPORT THE LOCAL ECONO- MY AND NEARBY BUSINESSES +3,198 JOBS NEW EMPLOYMENT OPPORTUNITIES + 4,384 DWELLINGS NEW RESIDENTIAL UNITS + 401,819 SQ. FT. NEW RETAIL SPACE + 473,887 SQ. FT. NEW OFFICE SPACE AT A GLANCE: Page 118 of 206 108CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN Thank you to the following individuals and groups who contributed to the preparation of the Northeast Gateway Redevelopment Plan REDEVELOPMENT PLAN WORKING GROUP Amina Alikhan Joel Cantrell Thomas Firsich Jennifer Fredericks Rolando Gonzalez Cortney Phillips Damen Smien Elianor Vessali CITY COUNCIL John Nichols, Mayor Mark Smith, Place 1 William Wright, Place 2 Linda Harvell, Place 3 Elizabeth Cunha, Place 4 Bob Yancy, Place 5 Dennis Maloney, Place 6 PLANNING & ZONING COMMISSION Dennis Christiansen, Chair Marcus Chaloupka Aron Collins Jason Cornelius Melissa McIlhaney Bobby Mirza David White Acknowledgements Page 119 of 206 109CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN ADMINISTRATION Bryan Woods, City Manager Jeff Capps, Deputy City Manager Jeff Kersten, Assistant City Manager Jennifer Prochazka, Assistant City Manager PLANNING & DEVELOPMENT SERVICES Michael Ostrowski, CeCD, AICP, Director Molly Hitchcock, AICP, Assistant Director Alyssa Halle-Schramm, AICP, LEED GA, Long Range Planning Administrator Matthew Ellis, AICP, Senior Planner – Project Manager Carl Ahrens, Transportation & Mobility Planner Anthony Armstrong, P.E., CFM, Land Development Review Administrator Katherine Beaman-Jamael, Graduate Transportation & Mobility Engineer Samantha Beckman, Planning Intern Brian Binford, CBO, Building Official Erika Bridges, P.E., CFM, Assistant City Engineer Carol Cotter, P.E., CFM, City Engineer Crystal Fails, Staff Assistant David Hahn, GIS Technician Lucas Harper, P.E., Civil Engineer Kristen Hejny, Administrative Support Specialist Ashley Klein, Planning Intern Robin Macias, Staff Planner Aspen Pflanz, Transportation & Mobility Planner Elise Sawyer, GIS Intern Gabriel Schrum, Staff Planner Jason Schubert, AICP, Transportation Planning Coordinator Gillian Sitler, Graduate Civil Engineer Naomi Sing, Staff Planner Julie Svetlik, CFM, GIS Analyst Bryce Trujillo, Assistant Building Official Page 120 of 206 110CSTX.GOV | NORTHEAST GATEWAY REDEVELOPMENT PLAN STAFF RESOURCE TEAM Jennifer Cain, Director of Capital Improvement Projects Timothy Crabb, Director of Electric Utility Debbie Eller, Director of Community Services Emily Fisher, Director of Public Works Theo Garcia, Civil Engineer, Water Services Alan Gibbs, Assistant Director of Water Services Randall Lewis, Assistant Director of Electric Utility Emily Lopez, Graduate Civil Engineer, Water Services Stephen Maldonado Jr., Assistant Director of Water Services Ramiro Martinez, Engineering Operations Manager, Water Services Rachel Mayor, Multimedia Manager Gary Mechler, Director of Water Services Barbara Moore, Assistant to the City Manager Brian Piscacek, Assistant Director of Economic Development & Tourism Gustavo Roman, Assistant Director of Community Services Natalie Ruiz, Director of Economic Development & Tourism Debbie Stickles, Electric Design Supervisor, Electric Utility Lucero Valenzuela, Multimedia Coordinator CONSULTANTS Asakura Robinson Andrew Knuppel, AICP, CFM – Project Manager Mary Allen – Deputy Project Manager Kyle Anderson Daniel Khuat Zixin Li Tess Matzakos Page 121 of 206 cstx.gov Page 122 of 206 M AP 6.3 Functional Classification & Context Class UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRSOUT H WEST SOUT H WEST PKWYPKWYFM 281 8 FM 281 8 TE X A S A V E S TE X A S A V E S F M 2 1 5 4 F M 2 1 5 4 SH 6 S SH 6 SHARVEY RDHARVEY RDGRAHAM RDGRAHAM RDBARRON RDBARRON RDHOL LEMAN DR SHOL LEMAN DR S SH 6 S SH 6 SWILLIAM D. FITCH PKWYWILLIAM D. FITCH PKWYROCKROCKPRAIRIEPRAIRIE RDRD GREENS PRAIRIE RDGREENS PRAIRIE RDHWY 30 FM 2 1 5 4 FM 2 1 5 4FM 60FM 60MINOR COLLECTOR MAJOR COLLECTOR MINOR ARTERIAL 4 LANE MAJOR ARTERIAL 6 LANE MAJOR ARTERIAL FREEWAY/EXPRESSWAY GRADE SEPARATION THOROUGHFARE PLAN URBAN CORE GENERAL URBAN SUBURBAN RURAL CONTEXT ZONES CITY LIMITS ETJ BRYANBRYAN Page 123 of 206 BRYAN TEXASAVSGEORGEBUSHDRTEX A S A V WE L L B O R N R DUNIVERSITY DRH A R VEYM ITC HELLPWSVIC T O R I A A V E29THST WELSHAV WILLIAM D FITCH PWLINCOLN AVHOLLEMANDRUNIVERSITYDREBOONVILLERD SOUTHWESTPW N H A R V E Y M I T C H E L L P W STEXASAV BARRONRDHARVEYRDEVILLAMARIARDWVILLAMARIARDFM 21 5 4TARROW ST HOLLEMA N DRECAVITTAV ANDERSONST HOLLEMANDRWLEONARD RDDARTMOUTH S TGROESBECKSTE A R L R U D D E R F W SBRIARCREST DRS CO LLE GE AV RAYMONDSTOTZERPWWSH21 N E A R L R U D D E R F W GEORGEBUSHDRWFINFEATHERRDROCKPRAIRIERD C A P S T O N E D R SH 6 SGREENS PRAIRIE RDFM 2 1 5 4HARV EYMITCHELLPW S RIVERSIDEPW S H 6 S SH 30 FM158 SH 6 S WILLIAM D FITCH PWRIVERSIDEPW RAYMONDSTOTZERPWMAP 2.6 Proposed Bicycle FacilitiesMAP 5.4 GU L F S T A T E S U T I L I T I E S E A S E M E N T Multi-use Path Proposed Grade Separation Existing Grade Separation Funded Grade Separation Proposed Brazos County College Station City Limits Easterwood Airport CSISD Property Texas A&M University Property College Station Parks College Station Greenway CSISD Schools Brazos Streets Bike Route Proposed Bike Route Existing Bike Lane Funded Bike Lane Existing 0 10.5 Miles Bike Facility Proposed Multi-use Path Existing Multi-use Path Funded College Station ETJ Page 124 of 206 BRYAN GU L F S T A T E S U T I L I T I E S E A S E M E N T TEXASAVSGEORGEBUSHDRTEX A S A V WE L L B O R N R DUNIVERSITY DRH ARVEYMITCH ELLPWSVIC T O R I A A V E 2 9 THST WELSHAV WIL LI A M DFITCHPWLINCOLN AVHOLLEMANDRUNIVERSITYDREBOONVILLERD SOUTHWESTPW N H A R V E Y M I T C H E L L P W STEXASAV BARRONRDHARVEYRDWVILLAMARIARDTARROWSTHOLLE M A N DRECAVITTAV ANDERSONST HOLLEMANDRWLEONARD RDDARTMOUT H S TSOUTHWEST PW EE VILLAMARI ARDE A RL R U D D E R F W SGROESBECKST FM 2 1 5 4 S COLLE G E AV RAYMONDSTOTZERPWW SH 21N E A R L R U D D E R F W GEORGEBUSHDRWFINFEATHERRDROCKPRAIRIERD C A P S T O N E D R SH 6 SGREENS PRAIRIE RDFM 2 1 5 4 H A R VEY MITCHELLPW S RIVERSIDEPW S H 6 S SH 30 FM158 SH 6 S WILLIAM D FITCH PWRAYMONDSTOTZERPWProposed Pedestrian FacilitiesMAP 5.5 Sidewalk Existing Sidewalk Funded Sidewalk Proposed Multi-use Path Proposed Grade Separation Existing Grade Separation Funded Grade Separation Proposed Brazos County College Station City Limit Texas A&M University Property Easterwood Airport CSISD Property College Station Parks College Station Greenway CSISD Schools Brazos Streets 0 10.5 Miles College Station ETJ Multi-use Path Existing Multi-use Path Funded Page 125 of 206 September 18, 2023 Item No. 3.3. Wellborn District Plan Update Sponsor: Michael Ostrowski, Director of Planning and Development, Jason Schubert Reviewed By CBC: N/A Agenda Caption: Public Hearing, presentation, discussion, and possible action regarding a recommendation to the Planning and Zoning Commission on the transportation and mobility components within the Wellborn District Plan, the associated changes to the Comprehensive Plan Functional Classification & Context Class Map, and the associated maps in the Bicycle, Pedestrian, and Greenways Master Plan including the Proposed Bicycle Facilities Map and the Proposed Pedestrian Facilities Map. Case# CPA2023-000002. (Note: Planning and Zoning Commission action on this item is scheduled for October 5, 2023. Final action on this item is scheduled for the October 12, 2023, City Council Meeting – subject to change.) Relationship to Strategic Goals: • Good Governance • Financial Sustainability • Core Services & Infrastructure • Neighborhood Integrity • Diverse & Growing Economy • Improving Mobility Recommendation(s): Staff recommends approval. Summary: The Wellborn District Plan, an important priority project from the FY23 PDS Plan of Work, has been underway since January 2023. This item comes from Comprehensive Plan Action 2.2, to prioritize and undertake detailed small area plans for priority areas. The Wellborn area has experienced changed conditions in recent years and is facing continued development pressures for growth. The Wellborn District Plan aims to create a cohesive district that reflects the residents’ vision for the community, recognizes the unique character of Wellborn, and supports the overall vision of College Station. Staff engaged the community throughout the planning effort by hosting five working group meetings, six area-wide meetings, and a virtual area-wide meeting, as well as a virtual engagement website to gather community feedback. Additionally, staff coordinated with representatives from the Texas Department of Transportation on the future widening of FM 2154 and its impact on the planning area. City staff also worked internally to ensure the plan meets the needs of all departments and maintains the City’s excellent services. Background: The Wellborn District Plan is an updated planning effort built upon the Wellborn Community Plan’s foundation, which established a vision and planned for coordinated actions from 2013-2023. Updating this small area plan offered the opportunity to take a closer look at the Wellborn area within the City of College Station, develop area-specific approaches to implementing the Comprehensive Plan, and directly engage with residents on the future of their area. Page 126 of 206 This update covers 2023-2033 and serves as a statement of the Wellborn community’s vision for the future. It provides goals and actions on a broad range of topics and provides strategic direction to maintain the rural character of Wellborn while managing small-scale growth and maintaining a high quality of life. The relevant transportation and mobility components can be found within Chapter 3. Integrated Mobility on pages 18-26. Staff will present the transportation and mobility components within the Wellborn District Plan, the associated changes to the Comprehensive Plan Functional Classification & Context Class Map (Thoroughfare Plan), and the associated maps in the Bicycle, Pedestrian, and Greenways Master Plan including the Proposed Bicycle Facilities Map and the Proposed Pedestrian Facilities Map to the Board for consideration and possible recommendation. Staff will present the Board’s recommendation to the Planning and Zoning Commission at their October 5, 2023 meeting and to the City Council at their October 12, 2023 meeting. Budget & Financial Summary: N/A Attachments: 1. Wellborn District Plan 2. Functional Classification & Context Class Map, from the Comprehensive Plan 3. Proposed Bicycle Facilities Map, from the Bicycle, Pedestrian & Greenways Master Plan 4. Proposed Pedestrian Facilities Map, from the Bicycle, Pedestrian & Greenways Master Plan Page 127 of 206 WELLBORN DISTRICT PLAN Adopted October 12, 2023 Page 128 of 206 2CSTX.GOV | WELLBORN DISTRICT PLAN Contents CHAPTER 1 Plan Foundation CHAPTER 2 Distinctive Places CHAPTER 3 Integrated Mobility CHAPTER 4 Plan Implementation APPENDIX A Existing Conditions APPENDIX B Public Engagement Summary 5 11 18 27 31 53 Page 129 of 206 3CSTX.GOV | WELLBORN DISTRICT PLAN MAPS Map 2.1: Future Land Use & Character Map Modifications Map 3.1: Thoroughfare Plan Modifications Map 3.2: Bicycle Plan Modifications Map 3.3: Pedestrian Plan Modifications Map A.1: Existing Land Use Map A.2: Existing Zoning Map A.3: Code Enforcement Case Density Map A.4: Development Activity Map A.5: Existing Thoroughfare Plan Map A.6: Existing Bicycle Plan Map A.7: Existing Pedestrian Plan Map A.8: Crash Density Map A.9: Water Service Areas Map A.10: Wastewater Service Areas Map A.11: Electric Service Areas Map A.12: Floodplain Contents 14 21 23 24 34 35 38 40 43 44 45 47 49 50 51 52 Page 130 of 206 4CSTX.GOV | WELLBORN DISTRICT PLAN FIGURES Figure 1.1: Wellborn District Boundary Figure 1.2: Planning Process Figure 2.1: Rural Community Concept Figure 2.2: Central Sign Element Concept TABLES Table 4.1: Implementation Matrix Table A.1: Code Enforcement Cases, 2012-2022 Table A.2: Development Activity, 2012-2022 Contents 6 7 16 16 30 37 39 Page 131 of 206 ADOPTED OCTOBER 12, 2023 The Wellborn District Plan is an updated planning effort built upon the Wellborn Community Plan’s foundation, which established a vision and planned for coordinated actions from 2013-2023. Updating this small area plan offers the opportunity to take a closer look at the Wellborn area within the City of College Station, develop area- specific approaches to implementing the Comprehensive Plan, and directly engage with residents on the future of their area. This update covers 2023-2033 and serves as a statement of the Wellborn community’s vision for the future. It provides goals and actions on a broad range of topics and provides strategic direction to maintain the rural character of Wellborn while managing small-scale growth and maintaining a high quality of life. In October 2033, on the 10-year anniversary of this plan’s adoption date, the plan is officially retired and serves as a historical reference only. Subsequently, the City of College Station can choose to analyze whether a renewed planning effort is warranted or whether the goals of this plan have been satisfactorily implemented. Similarly, with the adoption of this updated plan in 2023, the original Wellborn Community Plan is retired and serves as a historical reference. PLAN FOUNDATION1 Page 132 of 206 6CSTX.GOV | WELLBORN DISTRICT PLAN Planning Area The Wellborn District is located in the southwestern portion of the city and includes much of what remains of the historic Wellborn community. The planning area is made up of over 929 acres and is bounded by I&GN Road, Victoria Avenue, Royder Rd, Barron Cut-off Road, and Capstone Drive as shown in Figure 1.1: Wellborn District Boundary. This area includes a mix of ranch and acreage lots, with commercial uses located along the primary thoroughfare (FM 2154). There are approximately 470 residents who live within the planning boundary. The area was annexed into the City of College Station in 2011. That process was contentious, and the development of the original Wellborn Community Plan following annexation provided residents, landowners, and business owners the opportunity to help shape the plan’s focus on preserving the rural and historical character of Wellborn. The planning area for the 2013 plan, as well as this 2023 update, covers the annexed areas and adjacent properties that are under non-annexation development agreements. In 2022, a small area plan audit found that about 60% of the actions of the Wellborn Community Plan were completed. Figure 1.1: Wellborn District Boundary Page 133 of 206 7CSTX.GOV | WELLBORN DISTRICT PLAN Plan Creation RELATIONSHIP TO THE COMPREHENSIVE PLAN The need to update the Wellborn Community Plan was identified by community members, City staff, the Planning and Zoning Commission, and the City Council during the evaluation and adoption of the Comprehensive Plan in 2021. Many participants of that process acknowledged continued development pressures in the area and that small-scale growth in limited areas may be appropriate. The Comprehensive Plan calls for the renewed planning effort in the Wellborn area and Comprehensive Plan Action 2.2 directs staff to prioritize and undertake detailed plans for priority neighborhoods, districts, corridors, or redevelopment areas. The Wellborn District Plan update was identified as a high priority project by the Planning and Zoning Commission and the City Council. This is the second small area plan to be adopted under the 2021 City of College Station Comprehensive Plan. PLANNING PROCESS In November 2022, City staff began compiling existing conditions data of the planning area to identify changes in the area and trending conditions in preparation for the first public meetings. A key component of plan creation is ensuring that the residents within the area are involved in developing the vision for the planning area. Through this planning effort, residents were engaged multiple times between January and August 2023. There were a total of six area-wide meetings for this planning effort, five of which were in- person, and one was held virtually. Each meeting progressed further into the planning process and asked residents to provide feedback on a range of topics. The beginning phase included community visioning and brainstorming for the future of Wellborn. During the Phase 1 meetings, participants were asked to evaluate the existing plan goal statements, the strengths of the area that should be maintained, and any potential changes. One of the initial topics of concern was the planning boundary. City staff analyzed a larger boundary than the original Wellborn Community Plan to holistically assess the pressures placed on the community including traffic, congestion, housing density, and demand for utilities. While the original boundary is being honored within this updated plan, residents within and around the planning area participated in the planning effort, and all feedback was considered during this plan update. There are a few established neighborhoods that border the Wellborn planning boundary – Creek Meadows subdivision, Sweetwater Forest, and Estates at Royder to name a few. City staff organized the Phase 1 comments into broader categories that helped inform the second phase of public engagement, as well as revised the goals based on resident feedback. The Phase 2 meetings focused on defining what rural character looks like within Wellborn, where different land uses should be located, and began to draft actions that will help implement the goals. City staff hosted an additional meeting during Phase 2 to focus on infrastructure within the district including water and wastewater provision and service limitations, capital projects within the area, and the ongoing FM 2154 widening project being led by the Texas Department of Transportation (TxDOT). Page 134 of 206 8CSTX.GOV | WELLBORN DISTRICT PLAN While a separate project, the FM 2154 widening project was a topic of interest and concern to many meeting participants throughout the first two rounds of public engagement. As such, City staff invited TxDOT representatives to two area-wide meetings to provide more details about the widening project and to hear directly from community members. City staff wrapped the first two phases of the planning effort by conducting workshops with the Planning and Zoning Commission and City Council to explain the process and public input received thus far and ask for input and direction. The City Council directed staff to maintain the original boundaries of the Wellborn plan based on public input. The third and fourth stages of the planning effort involved proposed changes to the Comprehensive Plan’s Future Land Use & Character Map and Thoroughfare Plan, and the Bicycle, Pedestrian, and Greenways Master Plan maps and testing those proposed changes with meeting participants. Staff then worked to incorporate resident feedback and finalize the plan document and its associated map. The final stage of this planning effort included meetings with the Bicycle, Pedestrian, and Greenways Advisory Board, the Planning and Zoning Commission, and City Council. The final plan was presented to the board and commission for their recommendation. The plan, along with the recommendations from the board and commission, was forwarded to the City Council for final adoption. After adoption, plan implementation will occur over the planning horizon through City investments in infrastructure and programs, changes in regulations and policies that support Wellborn’s rural character, and private development decisions. PROJECT TEAMS Every planning effort requires coordination between community members, stakeholders, staff, and appointed and elected officials. This planning effort engaged a working group of volunteers, City staff, the Planning and Zoning Commission, the City Council, and the general public to build the plan’s vision, goals, and actions. Members of the various project teams are identified in the Acknowledgements at the end of the plan. Staff Resource Team The Staff Resource Team consisted of representatives from each department within the City to shepherd the plan and offer internal coordination opportunities. The Staff Resource Team met after each phase of the project to talk through any new information or decisions and confirm the roadmap for the next phase of the project. Page 135 of 206 9CSTX.GOV | WELLBORN DISTRICT PLAN Planning & Development Services Resource Team The Planning & Development Services Resource Team was comprised of staff from each of the divisions within the Planning & Development Services department to provide periodic updates and prepare for meetings with the Staff Resource Team and Working Group. This team met every other month in addition to bi-weekly check-ins on progress. Working Group The Working Group was a group of individuals who volunteered to help City staff determine the direction of the plan and provide more focused input throughout its creation. The group was comprised of 37 property and business owners and residents within or around the planning area. Participants learned about small-area planning, offered direction on specific components of the plan, and served as ambassadors for the project in their community circles. The group met four times during the planning process to provide guidance to staff and feedback in advance of the area-wide meetings. This group also helped to advocate for the original Wellborn community and its history. Page 136 of 206 10CSTX.GOV | WELLBORN DISTRICT PLAN Plan Goals & Structure The Wellborn District Plan is of interest to community residents, investors, developers, business owners, and others interested in how the district will respond and adapt over the next 10 years. The plan is divided into topic-based chapters that each contain a specific goal, corresponding actions, narrative, and maps that provide direction to realize the community’s vision. CHAPTER 1: PLAN FOUNDATION The first chapter details the history and context of the plan area and provides an overview of the planning process and the public participation opportunities. CHAPTER 2: DISTINCTIVE PLACES GOAL: Preserve the core rural character of Wellborn with small-scale growth that enhances the uniqueness and history of the area. This chapter establishes planning strategies for future small-scale growth and appropriate development while balancing the community’s desire to maintain the rural roots of the Wellborn area. CHAPTER 3: INTEGRATED MOBILITY GOAL: Promote a safe, efficient, and connected mobility system that encourages transportation options while recognizing the lower density of the district. This chapter ensures the development of a cohesive and context-sensitive mobility network for all users within the district. This includes contextually appropriate integration of shared- use paths, road connections, and other changes identified through the planning process. CHAPTER 4: PLAN IMPLEMENTATION The final chapter establishes accountability for the execution of this plan and guides the necessary processes that come with plan implementation. It collates the plan actions from the previous chapters and identifies implementation priorities and strategies. Page 137 of 206 11CSTX.GOV | WELLBORN DISTRICT PLAN GOAL Preserve the core rural character of Wellborn with small-scale growth that enhances the uniqueness and history of the area. DISTINCTIVE PLACES2 Page 138 of 206 12CSTX.GOV | WELLBORN DISTRICT PLAN Purpose This chapter provides guidance for the preservation of the rural character of the Wellborn District. Future development within the area should fit within the established community vision for limited growth in appropriate areas that enhance the historic, rural feel of the community. The Wellborn District Plan accomplishes this by retooling the Wellborn zoning districts as design districts that enhance the rural character and further identifies opportunities for improvements that the City can implement in tandem with private development decisions. Input from the district’s residents and business owners identified a desire to preserve the natural and historical features of the original Wellborn community while also allowing small-scale development opportunities. Therefore, this plan places a high priority on maintaining the rural character of the district. Community Preservation & Design The historic Wellborn area dates to before the City of College Station was established. While most historical sites have been demolished over the years, there is a desire from the community to capture and highlight the community’s roots. Effective design helps to create places of distinction – places worth remembering and protecting – and contributes significantly to the quality of life. During the public engagement for this plan, participants expressed a desire to maintain larger residential lots to preserve the natural open space within the community as well as commercial buildings that have a unified design representative of the original ranch and homestead-style architecture seen within the area. This character has been captured through the Wellborn zoning districts that were established in 2016 after the adoption of the Wellborn Community Plan. These zoning districts are described in further detail later in this chapter. After hearing concerns from participants regarding certain aspects of the current zoning districts, this planning effort identified that the Wellborn zoning districts should become a design district within the Unified Development Ordinance (UDO), which could further require certain design elements for buildings within the planning boundary. Plan participants also made several comments about property owners not following municipal codes. A design district helps with community place-making and builds cohesion. Combining the design district with additional educational efforts increases the likelihood of compliance with the City’s standards. Page 139 of 206 13CSTX.GOV | WELLBORN DISTRICT PLAN Future Land Use Future land use serves as a guide for how all property within the city may develop in the future. Each future land use category contains a character-based description and overall intent of the category, along with generally appropriate zoning districts that help achieve the desired character. In determining appropriate land use classifications, the existing land use and character were considered. The planning processes included discussions that prompted participants to identify land uses they would like to see within the planning boundary. The result of those discussions is the proposed modifications to the Comprehensive Plan Future Land Use & Character Map listed below and shown visually within Map 2.1: Future Land Use & Character Map Modifications. FUTURE LAND USE MODIFICATIONS After the adoption of the Wellborn Community Plan in 2013, ten future land uses were created and implemented for the Wellborn planning area. In subsequent years, many stakeholders – including residents, business owners, developers, staff, and appointed and elected officials alike – noted that the granular level of Wellborn future land use categories was overly specific and unintentionally functioned in a “pre-zoning” fashion, requiring that most zoning change requests also involve a future land use change request. During the 2021 update to the Comprehensive Plan, there were no changes to the Wellborn future land uses, as this planning effort was anticipated to begin shortly after the updated Comprehensive Plan was adopted. With the adoption of this Wellborn plan update, the modifications help align the future land uses categories to other parts of College Station and the City’s updated Comprehensive Plan. The future land uses within the Wellborn District now include Neighborhood Commercial, Suburban Residential, Estate Residential, Rural, Business Center, Institutional/Public, and Natural & Open Areas. These are represented visually in Map 2.1 Future Land Use & Character Map Modifications, and the category descriptions and associated zoning district(s) that are generally appropriate are found within the City’s Comprehensive Plan. In addition to the map edits, there are revised future land use category descriptions within the Comprehensive Plan to better embrace the Wellborn area and its desired rural character. The edits include indicating that only the Wellborn zoning districts – WC Wellborn Commercial, WRS Wellborn Restricted Suburban, and WE Wellborn Estate – as well as the BP Business Park, BPI Business Park Industrial, CI Commercial Industrial, R Rural, and NAP Natural Areas Protected zoning districts are permitted zoning districts within the Wellborn District boundary. The specificity for Wellborn-only zoning controls remains and is embodied within the Wellborn zoning districts, which will be retooled into a Wellborn design district as an action within this plan. Page 140 of 206 [INSERT MAP 2.1: FUTURE LAND USE & CHARACTER MAP MODIFICATIONS – 11X17 PAGE SPREAD] Future Land Use & Character Map Modifications WELLBORN DISTRICT FM 2154FM 2154R O Y D E R R D R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD RO Y D E R R D RO Y D E R R DFM 2154R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD RO Y D E R R D DISTRICT BOUNDARY NEIGHBORHOOD COMMERCIAL SUBURBAN RESIDENTIAL ESTATE RESIDENTIAL RURAL NATURAL & OPEN AREAS INSTITUTIONAL/PUBLIC PARKS & GREENWAYS MAP 2.1 BUSINESS CENTER Page 141 of 206 15CSTX.GOV | WELLBORN DISTRICT PLAN Zoning The Wellborn Community Plan called for the creation of several zoning districts specifically for the Wellborn area. This led to the creation of three zoning districts: WC Wellborn Commercial, WRS Wellborn Restricted Suburban, and WE Wellborn Estate. While the Wellborn Community Plan also called for the creation of additional zoning districts, such as Wellborn Business Park, other citywide zoning districts were created and determined to meet the goals of the Wellborn Community Plan as well as the needs of the city as a whole. As of the writing of this plan, the Wellborn zoning districts are all being utilized in the Wellborn District. However, there are also zoning districts present in the planning area that are not Wellborn-specific districts; most of these properties were zoned before the creation of the Wellborn zoning districts in 2016. Additionally, when an area is annexed into the City of College Station it is automatically designated as R Rural, regardless of the existing or future land use. As much of this district has not been redeveloped since the area was annexed in 2011, most of the land within the planning area still reflects the R Rural zoning designation. As mentioned, this updated plan and the associated revisions to the Comprehensive Plan and its Future Land Use & Character Map will continue to support the need for Wellborn-specific zoning districts and will incorporate them into a Wellborn design district as an action in this plan. District Image Corridors & Gateways IMAGE CORRIDORS Image corridors are predominantly found on routes that many residents and visitors travel and can have a great impact on the character of the surrounding area. Within the Wellborn District, FM 2154 serves as the primary image corridor due to the high volume of individuals who use this roadway daily. Landscaping, streetscaping, decorative markers, and themed wayfinding signs should be uniformly utilized within this corridor to further enhance the character of the district. During the creation of the original Wellborn Community Plan, residents, property owners, and business owners participated in a design workshop to help visualize the rural character and history of Wellborn. With the community created around the Union Pacific railroad location, participants felt it was a key component that should be utilized in the creation of any identifying features to ensure that the rustic country feel was not lost. Those sentiments were identical during the plan update process. The results of the design workshop focused on creating a more pedestrian-friendly, village-type environment with small-scale businesses located along Live Oak Street, as shown in Figure 2.1: Rural Community Concept. Of note was the desire to have existing and new businesses still generally front toward FM 2154 and the railroad, but to incorporate side streets, front and rear building access, and to avoid having continuous backs of buildings along the primary thoroughfare of the community. As mentioned, participants a decade ago and today expressed a desire to embrace the community’s rural roots and history with the railroad. The vision to reorient toward Live Oak Street remains within this updated plan. Plan actions such as revising the land uses, extending Live Oak Street to connect to McCullough Road, and revising and implementing design district standards will help realize this vision for a new “main street” within the Wellborn community. Page 142 of 206 16CSTX.GOV | WELLBORN DISTRICT PLAN GATEWAYS The Wellborn District acts as the southwestern gateway into the city where visitors have a first glimpse of College Station and the district’s identity. Participants identified that they would like elements, such as street sign toppers and wayfinding signs, to establish a unified feel and sense of place within the district. Identifying features for gateway elements should incorporate items that reflect the rural and railroad history of Wellborn such as railroad ties, fences, and hitching posts. Primary gateway elements should be placed generally around the Barron Cut-Off Road and FM 2154 intersection, and south of the Greens Prairie Road and FM 2154 intersection. To tie the gateway and identifying elements together, unified plantings that lead from the gateway elements to the central point of the community should be utilized. Ultimately, these could lead to a larger sign element that could be placed within the core of the community, generally located around the Post Office. This sign element could convey historical information about Wellborn and be used as a central gathering place. This was visually represented during the Wellborn Community Plan’s creation, as shown in Figure 2.2: Central Sign Element Concept. Figure 2.1: Rural Community Concept Figure 2.2: Central Sign Element Concept. Page 143 of 206 17CSTX.GOV | WELLBORN DISTRICT PLAN Strategic Actions DP.1 Amend the Comprehensive Plan Future Land Use & Character Map and corresponding categories to incorporate the recommended modifications for Wellborn. This includes retiring the prior Wellborn land uses, assigning future land uses as determined through this planning process, and revising the appropriate future land use categories to specify where the Wellborn-specific zoning districts are the only zoning districts allowed within the plan boundary. DP.2 Retool the Wellborn zoning districts into a design district in the Unified Development Ordinance. To highlight the unique character of developments within the Wellborn District, the Wellborn-specific zoning districts should be reworked into a design district. The zoning standards should also be evaluated to determine if additional modifications are needed to enhance the rural character of Wellborn. DP.3 Create a village center around Live Oak Street to facilitate the area becoming the new “main street” for the Wellborn District. Revising the future land uses, extending Live Oak Street to connect to McCullough Road, implementing the revised design district standards and other appropriate place making strategies will help realize the vision for a new “main street” one block away from FM 2154. This change may also help spur additional small-scale commercial development along Live Oak Street. DP.4 Work with residents and business owners to assess the potential need, benefit, and structure of creating a Wellborn District Association. A Wellborn District Association comprised of local residents and business owners could collectively initiate actions to improve the Wellborn District and coordinate local events. Having an association registered with the City facilitates information sharing and courtesy notifications, including updates on development activity and City projects within the district. DP.5 Work with community stakeholders to create identification and gateway signage. These placemaking features should have details that reflect the community’s rural context. Consider including a central gateway element near the Post Office. City staff should collaborate with stakeholders on funding and location opportunities for improvements that highlight the Wellborn District identity. DP.6 Create opportunities for residents and visitors to engage with the history of the Wellborn District. This could also extend to a citywide scale to analyze the market needs for additional retail, commercial, and hospitality uses throughout the community. DP.7 Conduct enhanced outreach and educational efforts about local ordinances, Code Enforcement, and the SeeClickFix program. To expand the spread of information and encourage compliance with the Code of Ordinances, Code Enforcement officers could proactively share educational materials or host workshops in the Wellborn District. Page 144 of 206 18CSTX.GOV | WELLBORN DISTRICT PLAN GOAL Promote a safe, efficient, and connected mobility system that encourages transportation options while recognizing the lower density of the district. INTEGRATED MOBILITY3 Page 145 of 206 19CSTX.GOV | WELLBORN DISTRICT PLAN Purpose This chapter provides guidance for a contextualized mobility system in the Wellborn District that considers the needs of all users. A safe, efficient, and connected mobility system addresses vehicular, bicycle, and pedestrian movements within and through the area. The Wellborn District Plan accomplishes this by providing a street network to meet the capacity of the area and designated off-street bicycle and pedestrian facilities. During the public engagement for the plan, participants shared their desire for a mobility system that supports appropriate densities, includes safe and well-connected infrastructure, and is more user- friendly for all modes of mobility. Thoroughfares The Thoroughfare Plan within the Comprehensive Plan establishes a network of major streets comprised of collectors, arterials, and freeways that include various bicycle and pedestrian facilities. It is one of the two major planning components for the mobility system within the City of College Station. The Thoroughfare Plan uses the future land use designations in the Comprehensive Plan Future Land Use & Character Map to identify the future needs of the mobility system based on anticipated development patterns. Page 146 of 206 20CSTX.GOV | WELLBORN DISTRICT PLAN FUTURE STREET NETWORK The street network within the district consists of more than eight miles of existing streets with just over 0.5 miles of private streets. The future street network for the Wellborn District proposes one minor change to the Thoroughfare Plan; otherwise, the existing road network in addition to the Thoroughfare Plan is anticipated to be able to handle the needs of the planning area and surrounding area as they build out. While the City of College Station builds and maintains many of the roads within the planning area, the Texas Department of Transportation (TxDOT) collaborates with the City on plans, improvements, and maintenance for Wellborn Road (Farm-to-Market Road 2154 or FM 2154). One of the major discussion points that came up during the public engagement of this plan update was the FM 2154 widening project that was being designed when the planning effort started. The existing FM 2154 is a two-lane rural highway with center turn lanes in some areas and is proposed to be widened to be a 4 Lane Major Arterial. There were concerns regarding this expansion, including the replacement of center turn lane areas with controlled left turns and raised medians. Participants mentioned the potential impact on access to businesses along the corridor to receive products and customers if there is not adequate access. As a response to these concerns, City staff communicated resident concerns regarding the widening of the corridor to TxDOT and collaborated with them to have TxDOT representatives at several public meetings, empowering meeting participants to speak directly with TxDOT. The design of the corridor, at the time of this plan, has not been completed and TxDOT is continuing to evaluate the design and interact with area property owners and stakeholders to determine what revisions to the design may be needed. MODIFICATIONS TO THE THOROUGHFARE PLAN Small area planning efforts enable a closer look into an area’s needs and identify potential changes within the Thoroughfare Plan. Based on participants' desire for a safe and well-connected roadway system, there is one change to the Thoroughfare Plan, which is outside the plan boundary but will provide access for people in and around the planning area. Currently, there is a proposed connection between McCullough Road and Brewster Drive. However, there is only one planned north/south connection along McCullough Road and Brewster Drive between FM 2154 and WS Phillips Parkway. Thus, a 2 Lane Minor Collector connection is proposed between the proposed extension of McCullough Road and Brewster Drive and Barron Cut-Off Road. This road would likely be constructed by the developer when the development of the parcel occurs. This future connection to Barron Cut-Off Road will be the through movement of the Brewster Drive extension and provide the suburban style development to the east of planning area an alternate route to FM 2154 other than McCullough Road. Page 147 of 206 [INSERT MAP 3.1: THOROUGHFARE PLAN MODIFICATIONS – 11X17 PAGE SPREAD] Thoroughfare Plan Modifications FREEWAY/EXPRESSWAY PROPOSED FREEWAY/EXPRESSWAY 6 LANE MAJOR ARTERIAL PROPOSED 6 LANE MAJOR ARTERIAL 4 LANE MAJOR ARTERIAL PROPOSED 4 LANE MAJOR ARTERIAL MINOR ARTERIAL PROPOSED MINOR ARTERIAL MAJOR COLLECTOR PROPOSED MAJOR COLLECTOR MINOR COLLECTOR PROPOSED MINOR COLLECTORFM 2154FM 2154R O Y D E R R D R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEETT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWET D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D DISTRICT BOUNDARY SUBURBAN RURAL MAP 3.1 CONTEXT ZONES Page 148 of 206 22CSTX.GOV | WELLBORN DISTRICT PLAN Bicycle & Pedestrian Facilities The Bicycle, Pedestrian, and Greenways Master Plan is the other major planning component for the mobility system within the City of College Station. Written in 2010 and updated in 2018, the plan provides guidance for and lays out improvements for bicycle and pedestrian facilities throughout College Station. The Bicycle, Pedestrian, and Greenways Master Plan identifies opportunities for improved connectivity for on- and off-street facilities as roadway projects are pursued. Within the Wellborn Community Plan (2013), there were several modifications made to the Bicycle, Pedestrian, and Greenways Master Plan to reduce the number of bicycle and pedestrian facilities to meet the citizen vision of rural section roadways. The future facility network is comprised of more than 3 miles of existing on- and off-street bicycle facilities, off-street shared-use paths, and sidewalks, with over 5 miles of proposed facilities. Several changes are proposed by this plan to meet the needs of the planning area based on feedback received during the planning effort. MODIFICATIONS TO THE BICYCLE, PEDESTRIAN, AND GREENWAYS MASTER PLAN Small area planning efforts enable a closer look into an area’s needs and identify potential changes within the Bicycle, Pedestrian, and Greenways Master Plan. Through feedback received during the planning effort, several changes to the bicycle and pedestrian facilities are proposed within the area as a part of this planning effort. First, the majority of changes relate to planned bicycle facilities (typically bicycle lanes) and planned sidewalks being replaced with planned shared-use paths. Participants emphasized the desire for shared- use paths rather than separate sidewalks and bicycle lanes to reduce the amount of paved area along streets and maintain a more rural feel within the planning area. Shared-use paths enable pedestrian connectivity options while reducing the impact to the rural character of the area. Due to the design of rural roads, there would be more separation between pedestrians utilizing the shared-use paths and vehicles utilizing the street which also addresses safety concerns of having pedestrian facilities close to the street. The streets proposed to have a shared-use path are: • I&GN Road from Rock Prairie Road West to Greens Prairie Road; • South Dowling Road from I&GN Road realigned to the future Royder Road extension; • Barron Cut-off Road from FM 2154 to WS Phillips Parkway; • Victoria Avenue from FM 2154 to Woodlake Drive; • Woodlake Drive from Victoria Avenue to Greens Prairie Road; • Royder Road from Dymple Lane to FM 2154; and • Greens Prairie Road from I&GN Road to FM 2154. To provide additional connectivity to the existing system within and around the planning area, two new shared-use paths are proposed to provide a more complete network. First, along with the improvements to the FM 2154, TxDOT intends to construct a shared-use path. Adding this to the Bicycle, Pedestrian, and Greenways Master Plan acknowledges the new facility. Second, there is a new connection proposed along McCullough Road to connect the shared-use path along FM 2154 to Live Oak Street and the extension of Brewster Drive. Given the rural context, it is expected that a shared-use path would be provided only on one side of these roadways. All of these changes to the Bicycle, Pedestrian, and Greenways Master Plan would be constructed by development as it occurs or by the City through capital projects in the future. Page 149 of 206 [INSERT MAP 3.2: BICYCLE PLAN MODIFICATIONS – 11X17 PAGE SPREAD] Bicycle Plan Modifications BIKE LANE EXISTING BIKE LANE FUNDED BIKE FACILITY PROPOSED BIKE ROUTE EXISTING BIKE ROUTE PROPOSED SHARED-USE PATH EXISTING SHARED-USE PATH FUNDED SHARED-USE PATH PROPOSED GRADE SEPARATION EXISTING GRADE SEPARATION FUNDED GRADE SEPARATION PROPOSED DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJFM 2154FM 2154 R O Y D E R R D R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTON E D R CAPSTON E D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154 R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTON E D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D MAP 3.2 Page 150 of 206 [INSERT MAP 3.3: PEDESTRIAN PLAN MODIFICATIONS – 11X17 PAGE SPREAD] Pedestrian Plan Modifications SIDEWALK EXISTING SIDEWALK FUNDED SIDEWALK PROPOSED SHARED-USE PATH EXISTING SHARED-USE PATH FUNDED SHARED-USE PATH PROPOSED GRADE SEPARATION EXISTING GRADE SEPARATION FUNDED GRADE SEPARATION PROPOSED DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJFM 2154FM 2154 R O Y D E R R D R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLING RDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTON E D R CAPSTON E D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT DRDR EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154 R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLING RD BARRON CUT-OFF RDCAPSTON E D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T DR E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D MAP 3.3 Page 151 of 206 25CSTX.GOV | WELLBORN DISTRICT PLAN Traffic Signal and Access Management Several significant intersections manage the flow of traffic into and out of College Station along FM 2154, one of College Station’s major gateway roads. Since the Wellborn Community Plan was adopted in 2013, traffic along FM 2154 has steadily increased as more housing is developed south of College Station and outside the City limits. Two new signalized intersections have been installed at FM 2154 and Royder Road and FM 2154 and Greens Prairie Road. In addition, the City capital project to realign Capstone Drive to Barron Road includes a traffic signal at FM 2154. As part of the design for the FM 2154 widening project, TxDOT is evaluating other intersections along the corridor for potential improvements. Encouraging local circulation through street connections away from FM 2154 can help to provide access from side streets, minimize the need for curb cuts and driveway accesses near high-volume intersections, and improve perceptions of access within the area. The presence of secondary streets and internal connections can also support place-making in a rural context as local traffic is directed away from the 4 Lane Major Arterial and towards the local rural roadways. The Wellborn community was established due to its proximity to the railroad. The Union Pacific Railroad line that parallels FM 2154 can be traced back to 1867 and the old Houston and Texas Central Railroad. Since the adoption of the Wellborn Community Plan in 2013, the City has been working toward establishing a quiet zone along the Union Pacific Railroad. As capital projects along the railroad have been designed, they have been designed to allow future establishment of a continuous railroad quiet zone. It has been identified that the existing railroad crossing at Butte Drive may not be designed or modified to qualify as a quiet zone, so to extend the quiet zone through the planning area, the crossing at Butte Drive may need to be closed. However, this is the only public street entrance into the Shiloh subdivision currently. The City should evaluate providing an alternative access point for the subdivision to enable the potential closure of the railroad crossing at Butte Drive to allow the completion of a railroad quiet zone through the Wellborn District. Page 152 of 206 26CSTX.GOV | WELLBORN DISTRICT PLAN Strategic Actions IM.1 Add a new 2 Lane Minor Collector connection from the extension between McCullough Road and Brewster Drive to Barron Cut-off Road. The connection between the extension of Brewster Drive and McCullough Road and Barron Cut-Off Road provides a north/south thoroughfare parallel to FM 2154. IM.2 Revise various proposed sidewalks and bicycle facilities to shared-use paths. These changes support the plan vision for a rural context mobility system while meeting the City’s goal of a safe and connected multi-mobility network. These revisions are on I&GN Road, South Dowling Road, Barron Cut-off Road, Victoria Avenue, Woodlake Drive, Royder Road, and Greens Prairie Road. IM.3 Revise the proposed bicycle route to a shared-use path along I&GN Road. The shared-use path meets the goals for a safer, off-street option for bicycling and walking and helps maintain the rural road character for I&GN Road. IM.4 Add a shared-use path along FM 2154. As the Texas Department of Transportation improves FM 2154, they intend to add a shared-use path along the project. Adding this to City plans acknowledges the provided facility. IM.5 Add a shared-use path along McCullough Road. Adding this shared-use path connects north/ south and east/west bicycle and pedestrian routes inside the plan boundary and to surrounding areas. IM.6 Extend Live Oak Street from its current terminus near Church Street to McCullough Road. This facilitates Live Oak Street becoming a “main street” within the Wellborn District. It also establishes a parallel route through a main commercial area. IM.7 Relocate the existing railroad crossing at South Dowling Road to align with the Royder Road intersection with FM 2154. Coordinate with Union Pacific Railroad to relocate the railroad crossing to increase safety and connectivity. IM.8 Evaluate an alternative entrance into the Shiloh Subdivision to potentially close the railroad crossing at Butte Drive. Assess the feasibility of possible locations for an alternative access. If a viable alternative is identified, construction of the alternative will help facilitate implementation of a continuous railroad quiet zone corridor. Page 153 of 206 27CSTX.GOV | WELLBORN DISTRICT PLAN The success of the Wellborn District Plan requires the commitment of the City and the community to implement the goals of this plan. This chapter lays out several implementation methods and funding sources for accomplishing the goals and actions contained within the plan. Additionally, the implementation matrix outlines the timeframe, establishes implementation responsibilities and administration, and determines possible funding sources for actions within the plan. PLAN IMPLEMENTATION4 Page 154 of 206 28CSTX.GOV | WELLBORN DISTRICT PLAN Implementation Methods Generally, the actions of this plan fall into one of five methods: capital improvement, focused planning effort, policy-based decision, project/program, or regulation. Implementation of each category requires unique approaches and produces different results. Table 4.1: Implementation Matrix indicates the most appropriate implementation method for each action. CAPITAL IMPROVEMENTS Capital improvements are large-scale infrastructure projects that the City pursues through the Capital Improvement Projects department. These expansion, modification, rehabilitation, and replacement projects include streets, utilities, parks, and public facilities and buildings. To be implemented, actions in this category need to be added to the Capital Plan, funded, and constructed. FOCUSED PLANNING EFFORTS Focused planning efforts are studies, plans, and designs that various City departments complete to identify specific steps needed for implementation. Actions in this category need to be analyzed with resulting recommendations. Implementation of the recommendations is commonly pursued under a different action. This Wellborn District Plan is a focused planning effort. POLICY-BASED DECISIONS Policy-based decisions are direction that the Planning and Zoning Commission and City Council provide to City staff. These decisions get implemented in various policy, regulatory, and guidance documents to implement the direction from the elected and appointed officials of College Station. Direction should be sought on actions in this category, and City staff should take the appropriate steps for implementation. PROJECTS AND PROGRAMS Projects and programs are the broadest category of plan actions. These can include projects that are not considered capital improvements and programs that the City organizes administratively. Implementation of actions in this category should be assessed individually as there are a variety of ways to accomplish these actions. Generally, the action provides an indication of what implementation should consider and how it might be implemented. REGULATIONS Regulations are developed by the City to guide or permit allowable activities within College Station. These can include modifications to the City of College Station Code of Ordinances, including the Unified Development Ordinance (UDO), or another regulatory document under the jurisdiction of the City of College Station. To be implemented, actions in this category should be adopted in their respective regulatory documents. Page 155 of 206 29CSTX.GOV | WELLBORN DISTRICT PLAN Funding Funding for plan actions come from a variety of sources. Generally, the actions in the Wellborn District Plan can be funded by one or more of the following sources: City department budgets, the Capital Improvement Projects fund, state and federal grants, and/or private investment. All funding options should be explored, but Table 4.1: Implementation Matrix indicates the funding mechanisms that City staff have identified as most appropriate or likely to complete the action. DEPARTMENTAL BUDGETS Funding projects through City departmental budgets can be accomplished in two ways: using available funds and directing them towards the project or through service level adjustments (SLAs). SLAs are approved as part of the annual City budget process and can be for one-time or recurring expenses. Many of the actions in the Wellborn District Plan can be accomplished through departmental budgets. CAPITAL IMPROVEMENTS These are large infrastructure improvements that are most likely to be funded through the Capital Improvement Program funds. The projects from these funds are prioritized and budgeted on a rolling five-year Capital Plan. These funds are also allocated during the annual City budget process as one-time expenses. STATE AND FEDERAL FUNDING Funding opportunities from the state and federal government are also available, particularly in the areas of transportation and the environment. These funds are primarily available through grants but may also be through specific budget appropriations. Often, grant funding includes local matching requirements. Included in this funding source is Community Development Block Grants (CDBG) funds. A portion of the Wellborn area located west of FM 2154 (Wellborn Road) is currently eligible for CDBG funding. Eligibility may change in future years with updated Census data. PRIVATE INVESTMENTS Outside of government funding, private investments can be pursued through development exactions within the UDO, foundation investments, or donations to the City for specific projects. Page 156 of 206 Table 4.1: Implementation Matrix CHAPTERACTION NUMBERACTION ITEM TASK TYPE IMPLEMENTATION TIMELINE CITY – RESPONSIBLE PARTY PARTNERS – INTERNAL PARTNERS – EXTERNAL FUNDING SOURCES Short (1-3 years)Medium (4-7 years)Long (8-10 years)CITY / DEPT. BUDGETSCIP BUDGETGRANTSPRIVATECHAPTER 2: DISTINCTIVE PLACESDP.1 Amend the Comprehensive Plan Future Land Use & Character Map and corresponding categories to incorporate the recommended modifications for Wellborn. This includes retiring the prior Wellborn land uses, assigning future land uses as determined through this planning process, and revising the appropriate future land use categories to specify where the Wellborn-specific zoning districts are the only zoning districts allowed within the plan boundary. Policy-based decision X Planning & Development Services X DP.2 Retool the Wellborn zoning districts into a design district in the Unified Development Ordinance. To highlight the unique character of developments within the Wellborn District, the Wellborn-specific zoning districts should be reworked into a design district. The zoning standards should also be evaluated to determine if additional modifications are needed to enhance the rural character of Wellborn. Policy-based decision X Planning & Development Services Residents of Wellborn X DP.3 Create a village center around Live Oak Street to facilitate the area becoming the new “main street” for the Wellborn District. Revising the future land uses, extending Live Oak Street to connect to McCullough Road, implementing the revised design district standards and other appropriate place making strategies will help realize the vision for a new “main street” one block away from FM 2154. This change may also help spur additional small- scale commercial development along Live Oak Street. Policy-based decision, regulation, and capital improvement X Planning & Development Services Capital Improvement Projects X X X DP.4 Work with residents and business owners to assess the potential need, benefit, and structure of creating a Wellborn District Association. A Wellborn District Association comprised of local residents and business owners could collectively initiate actions to improve the Wellborn District and coordinate local events. Having an association registered with the City facilitates information sharing and courtesy notifications, including updates on development activity and City projects within the district. Project / program X Neighborhood Services Economic Development & Tourism Planning & Development Services Residents of Wellborn X X DP.5 Work with community stakeholders to create identification and gateway signage. These placemaking features should have details that reflect the community’s rural context. Consider including a central gateway element near the Post Office. City staff should collaborate with stakeholders on funding and location opportunities for improvements that highlight the Wellborn District identity. Capital improvement X Planning & Development Services Capital Improvement Projects Residents of Wellborn X X X DP.6 Create opportunities for residents and visitors to engage with the history of the Wellborn District. The Wellborn District predates the incorporation of the City of College Station with a rich history. A history of Wellborn was prepared in 2010 and could be a resource for the identification and preservation of the local history. Project / program X Planning & Development Services Neighborhood Services Economic Development & Tourism Residents of Wellborn X X DP.7 Conduct enhanced outreach and educational efforts about local ordinances, Code Enforcement, and the SeeClickFix program. To expand the spread of information and encourage compliance with the Code of Ordinances, Code Enforcement officers could proactively share educational materials or host workshops in the Wellborn District. Project / program X Community Services Planning & Development Services X CHAPTER 3: INTEGRATED MOBILITYIM.1 Add a new 2 Lane Minor Collector connection from the extension between McCullough Road and Brewster Drive to Barron Cut-off Road. The connection between the extension of Brewster Drive and McCullough Road and Barron Cut-Off Road provides a north/south thoroughfare parallel to FM 2154. Policy-based decision X Planning & Development Services X IM.2 Revise various proposed sidewalks and bicycle facilities to shared-use paths. These changes support the plan vision for a rural context mobility system while meeting the City’s goal of a safe and connected multi-mobility network. These revisions are on I&GN Road, South Dowling Road, Barron Cut-off Road, Victoria Avenue, Woodlake Drive, Royder Road extension, and Greens Prairie Road. Policy-based decision X Planning & Development Services X IM.3 Revise the proposed bicycle route to a shared-use path along I&GN Road. The shared-use path meets the goals for a safer, off-street option for bicycling and walking and helps maintain the rural road character for I&GN Road.Policy-based decision X Planning & Development Services X IM.4 Add a shared-use path along FM 2154. As the Texas Department of Transportation improves FM 2154, they intend to add a shared-use path along the project. Adding this to City plans acknowledges the provided facility.Policy-based decision X Planning & Development Services X IM.5 Add a shared-use path along McCullough Road. Adding this shared-use path connects north/south and east/west bicycle and pedestrian routes inside the plan boundary and to surrounding areas.Policy-based decision X Planning & Development Services X IM.6 Extend Live Oak Street from its current terminus near Church Street to McCullough Road. This facilitates Live Oak Street becoming a “main street” within the Wellborn District. It also establishes a parallel route through a main commercial area.Capital improvement X Capital Improvement Projects Planning & Development Services Public Works X X X IM.7 Relocate the existing railroad crossing at South Dowling Road to align with the Royder Road intersection with FM 2154. Coordinate with Union Pacific Railroad to relocate the railroad crossing to increase safety and connectivity.Capital improvement X Capital Improvement Projects City Manager’s Office Public WorksPlanning & Development Services Union Pacific Railroad Texas Department of Transportation X X IM.8 Evaluate an alternative entrance into the Shiloh Subdivision to potentially close the railroad crossing at Butte Drive. Assess the feasibility of possible locations for an alternative access. If a viable alternative is identified, construction of the alternative will help facilitate implementation of a continuous railroad quiet zone corridor. Capital improvement X Capital Improvement Projects Planning & Development Services City Manager’s Office Public Works Union Pacific Railroad Texas Department of Transportation X X X Page 157 of 206 31CSTX.GOV | WELLBORN DISTRICT PLAN APPENDIX A: EXISTING CONDITIONS Surrounding Context The Wellborn community was annexed into the City of College Station in April 2011. The Wellborn Community Plan, which gave residents a voice in managing the growth and development of the area, was adopted shortly thereafter in April 2013 and included a planning horizon from 2013 to 2023. The plan helped address concerns raised by residents that the rural and historic community character would be lost as development pressure loomed. As the Wellborn Community Plan reaches the end of its planning horizon, the City of College Station reexamined the area to analyze the changes that have occurred in the previous 10 years and prepare for the next 10 years. Renamed the Wellborn District Plan, this plan update aims to create a cohesive district that reflects the residents’ vision for the community, recognizes the unique character of Wellborn, and supports the overall vision of College Station. The Wellborn District is in the southwest portion of the city and intersects the extraterritorial jurisdiction. The City enforces land use, zoning, and subdivision and development standards within the city limits, but only regulates the subdivision of land within the extraterritorial jurisdiction. The City cannot enforce or establish regulatory tools to manage growth along the city’s periphery. The boundary of the area mirrors that of the Wellborn Community Plan, reflective of this plan’s intention to focus on the core of the historical Wellborn area. When the 2023 planning effort began, staff analyzed the area holistically including the impacts of several nearby subdivisions. Due to resident concern over potentially expanding the plan boundary to include surrounding areas, the original plan boundary has been retained. Demographics The Wellborn District’s population has remained consistent over the past 10 years. The Wellborn District population increased from approximately 300 people in 2013 to 468 in 2023, an increase of 56% based on estimates from the ESRI Living Atlas. The population makes up approximately 0.3% of the total city population. Page 158 of 206 32CSTX.GOV | WELLBORN DISTRICT PLAN AGE & SEX The current social makeup of the Wellborn District is an even mix of age groups and sex. The largest single age range is individuals between 15-24 years old, which comprise 18% of the district population based on estimates from the ESRI Living Atlas. Individuals between 25-34 years old make up roughly 13.5% of the population, 15% are between the ages of 35-44 years old, 12.5% are between the ages of 45-54 years old, and 9.5% are between 55-64 years old. The residents are 50% female and 50% male. The district is comprised of people of all ages and is distributed evenly between women and men. RACE & ETHNICITY The area has a higher percentage of individuals who identify as White at 70% as compared to 62.3% citywide. The district also has 14% of people who identify as Hispanic, 12% who identify as Asian, 11% who identify as two or more races, 4% who identify as Black or African American, and 3% who identify as some other race based on estimates from the ESRI Living Atlas. When comparing these percentages to the city, Wellborn has a less racially diverse population than the city. FAMILY SIZE & INCOME As of 2023, the population estimate of the district is 468 individuals. There are 74 households within the district with an average family size of 3.6 individuals. The median household income is $98,276 and the per capita income is $43,946 based on estimates from the ESRI Living Atlas. When looking at the rest of the city, the district has a higher average household income and a lower per capita income. EDUCATION Educational attainment data is reflected in the American Community Survey by respondents selecting their highest level of educational attainment. This is measured by calculating the number of residents who have graduated from high school and/ or graduated from college. A majority of the population within the Wellborn district have achieved a bachelor’s degree or a graduate degree, representing roughly 64% of area residents. Approximately 10% hold an associate degree, 15% have attended some college without graduating, and 9.5% are high school graduates. Wellborn residents have graduated college at a similar rate compared to the rest of College Station. When looking at all demographic data presented, this district is less racially diverse, has a higher median income, and is more evenly distributed by age than College Station as a whole. This can be attributed to the location of the district within the city, as it is farther away from the Texas A&M University campus and predominantly contains medium to low-density single- family residences and large acreage properties, which often are owned by more affluent residents. Page 159 of 206 33CSTX.GOV | WELLBORN DISTRICT PLAN District Character EXISTING LAND USE The district is primarily made up of a mix of single-family residential lots and undeveloped land, with some commercial and light industrial uses as well. Residential uses make up just over 39% of the area and approximately 36% of the area is undeveloped, reflecting the rural character of the area. Public and semi-public uses comprise just over 10% of the land uses in the district, and the remaining areas are light industrial or commercial uses, including retail and restaurants. FUTURE LAND USE The future land use designations within the district are grounded in historical land use patterns. In 2013, the Wellborn Community Plan classified future land uses into eight categories – Wellborn Business Park, Wellborn Commercial, Wellborn Suburban, Wellborn Restricted Suburban, Wellborn Preserve, Wellborn Preserve-Open, Wellborn Estate, and Wellborn Estate-Open. Other future land uses in the area include Estate Residential, Suburban Residential, Institutional/Public, Natural & Open Areas, and Rural, all of which support the rural character represented in the original Wellborn Community Plan. During the 2021 Comprehensive Plan Update, the eight land use designations specific to the Wellborn area were grouped and depicted simply as Wellborn, while also retaining the underlying future land uses. This change was made in anticipation of this Wellborn District Plan update effort in 2023, recognizing that residents would be reengaged to further discuss the future of Wellborn. Appropriate modifications to the future land uses will be made with this planning effort. In general, anticipated changes will continue to prioritize maintaining rural character with open space that is both privately and publicly held and small-scale commercial uses that support nearby low-density residential properties. ZONING The zoning of the area reflects the future land use categories detailed above and the vision of the Wellborn Community Plan. One of the recommendations from the 2013 plan was the creation of several Wellborn- specific zoning districts. Following the plan’s adoption, staff created the WC Wellborn Commercial, WRS Wellborn Restricted Suburban, and WE Wellborn Estate zoning districts in late 2016. Only the WC Wellborn Commercial and WRS Wellborn Restricted Suburban zoning districts actively exist on properties within the district today, though the WE Wellborn Estate zoning is still an available option for property owners. There are currently four zoning districts on the ground within the district – WC Wellborn Commercial, SC Suburban Commercial, WRS Wellborn Restricted Suburban, and R Rural. The zoning in Wellborn reflects the low-density residential and commercial uses of the area. The properties zoned SC Suburban Commercial were zoned before the creation of the WC Wellborn Commercial zoning district. A few properties have made use of PDD Planned Development Districts, which is a customized zoning district option that utilizes a base zoning of one of the other districts mentioned above with modifications. PDD Planned Development Districts within the area have primarily been utilized for moderate-density single- family subdivisions. Properties that are zoned R Rural account for 85.5% of the area. When areas are annexed into the City of College Station, they are assigned the R Rural zoning designation. The majority of lots in Wellborn have not undergone a zoning change since annexation. Page 160 of 206 [INSERT 11X17 EXISTING LAND USE MAP] Existing Land Use FM 2154FM 2154RO Y D E R R D RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D SINGLE- FAMILY RESIDENTIAL MOBILE/ MANUFACTURED HOME COMMERCIAL RETAIL COMMERCIAL OFFICE COMMERCIAL OTHER PUBLIC FACILITIES SEMI-PUBLIC TRANSPORTATION, UTILITIES & COMMUNICATION COMMON AREA UNIMPROVED LIGHT INDUSTRIAL AGRICULTURAL RURAL DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJ MAP A.1 Page 161 of 206 [INSERT 11X17 EXISTING ZONING MAP] Zoning WELLBORNDISTRICT FM 2154FM 2154RO Y D E R R D RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLING RDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTON E D R CAPSTON E D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT DRDR EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLING RD BARRON CUT-OFF RDCAPSTON E D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T DR E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJ R R R WRS WRS PDD PDD WC PDD SC WC PDD WC WC WC SC WC SC R R SC R R R R R R R RURAL E ESTATE RS RESTRICTED SUBURBAN SC SUBURBAN COMMERCIAL GC GENERAL COMMERCIAL PDD PLANNED DEVELOPMENT DISTRICT GS GENERAL SUBURBAN R-1B SINGLE FAMILY RESIDENTIAL WC WELLBORN COMMERCIALww WRS WELLBORN RESTRICTED SUBURBAN w w MAP A.2 Page 162 of 206 36CSTX.GOV | WELLBORN DISTRICT PLAN HOUSING CHARACTERISTICS Housing in the district illustrates the single-family nature of the area. According to the ESRI Living Atlas, 83% of the 163 housing units are owner-occupied, which is an increase from 2010 when 65% of the 83 housing units were owner-occupied. This trend is also seen in the number of housing units that are registered with the City’s Rental Registration program which sits at only 12%. Of the owner-occupied housing units, the average home value is $375,000 which is higher than the city’s average home value of $368,995 as of July 2023. NEIGHBORHOOD CENTERS Neighborhood centers are areas where individuals naturally congregate when they are outside of their homes. This includes schools, churches, commercial areas, or a general gathering point that primarily serves residents. Three schools operated by the College Station Independent School District serve the Wellborn area and neighborhoods nearby. Wellborn Middle School is located within the boundary of this planning effort while Greens Prairie Intermediate School and Pecan Trail Elementary School are just outside of it. There are also several churches in the area including Wellborn Baptist Church, Saint Meena Coptic Orthodox Church, and Salem Baptist Church. Additional neighborhood centers include the Wellborn Community Center and America’s Country Store that both act as congregating locations while catering to different needs for residents. Page 163 of 206 37CSTX.GOV | WELLBORN DISTRICT PLAN CODE ENFORCEMENT Code Enforcement responds to complaints made regarding a wide range of issues that typically do not require the attention of law enforcement. The district had 114 code enforcement cases in the past decade ranging from illegal signs and use violations to property maintenance complaints. The most common code violations were illegal signs, amounting to just over 25% of cases. The City regulates and permits signage under specific standards. If a property does not have its signage permitted through the City, then this would result in a code enforcement case violation. The second highest violation at just over 20% was violating the City’s Rental Registration program requirement. These violations were usually due to properties still functioning as a rental without renewing their registration with the City. The third largest issue was general property maintenance concerns with almost 15% of all cases. During these investigations, Code Enforcement officers reach out to property owners to ensure their structure is safe to live in and help them find resources to ensure the structure complies with the City of College Station Code of Ordinances. Table A.1, Code Enforcement Cases, 2012-2022 reflects the past 10 years of code enforcement cases within the district. Table A.1: Code Enforcement Cases, 2012-2022 Code Violation Type Number of Cases Accumulation of Trash Trash over-flow, typically in yards 5 Cans Out After Collection Day Trash cans still on curb after trash collection day 0 Illegal Signs Signs that are being displayed are prohibited per the City Code 29 Junk Motor Vehicles Dilapidated cars are left in the yard, visible from the street 12 Liquor License Expired Business establishments running with an expired liquor license 3 Non-Specific Investigation General inquiries/complaints that don’t fit into a specific violation-type 3 Open Storage Storage visible from the street 0 Parking Illegal parking violations 4 Property Maintenance Property is not being maintained, including structural and safety issues 17 Rental Registration A property’s Rental Registration with the City has expired 23 Use Violations Prohibited use type is being used 15 Weeds & Grass A property’s yard is not being properly maintained 3 Page 164 of 206 [INSERT 11X17 CODE ENFORCEMENT CASE DENSITY MAP] CODE ENFORCMENT DENSITY* MID HIGHLOW Code Enforcement Case Density Code Enforcement Cases collected by the College Station Code Enforcement Division from 2012-2022 was used to map code issues. These are cases concerning compliance with *Based on the number of cases within a 250 foot radius codes related to: parking, weeds & grass, health & safety, zoning violations, sanitation & illegal dumping.FM 2154FM 2154R O Y D E R R D R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJ MAP A.3 Page 165 of 206 39CSTX.GOV | WELLBORN DISTRICT PLAN DEVELOPMENT ACTIVITY The City of College Station manages requests and reviews of development proposals and administers development standards through a variety of processes. One development project often necessitates multiple processes, reviews, permits, and inspections before it can be constructed and occupied. An example is a new commercial center that could require a Final Plat, a Development Permit, a Site Plan Review, an Architectural Review, and a Building Permit with inspections. Another example is a new residential subdivision that could require a Zoning Map Amendment, a Preliminary Plan, Final Plats, and Building Permits with inspections. Each project is analyzed for the permits or reviews that will be needed, and in what order those must be obtained. Each permit or review undergoes review by numerous staff in various departments throughout the City. Before the initiation of a project, the City offers pre-application conferences that allow all applicable reviewing departments to communicate the expectations of the project clearly to a future applicant to assist with quicker reviews down the line. Table A.2, Development Activity, 2012-2022 shows archived and approved project applications over the last 10 years within the district boundaries. Common applications included rezonings to districts supported by the Wellborn Community Plan, site plans for commercial properties, and right-of-way permits. Pre- application conferences were also common and the frequency of these has increased in recent years, which shows increasing pressures to develop within the area. Table A.2: Development Activity, 2012-2022 Review Type Number of Reviews Annexations 2 Appeals, Waivers, and Variances 1 Architectural Reviews 8 Commercial Final Plats 1 Comprehensive Plan Amendments 3 Development Permits 3 Pre-Application Conferences 26 Preliminary Plans 1 Residential Final Plats 3 Rezonings 10 Right-of-Way Permits 6 Site Plans 9 Page 166 of 206 [INSERT 11X17 NEW DEVELOPMENT MAP] FM 2154FM 2154 RO Y D E R R D RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D RBARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD RO Y D E R R D RO Y D E R R DFM 2154 RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D RBARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD RO Y D E R R D DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJ COMMERCIAL NON-RESIDENTIAL MULTI-FAMILY RESIDENTIAL SINGLE FAMILY RESIDENTIAL Development Activity SS DODOWLIWLI RDRD S DOWLI RD NNNGGG MAP A.4 Page 167 of 206 41CSTX.GOV | WELLBORN DISTRICT PLAN PUBLIC INVESTMENTS As the Wellborn District and surrounding areas have grown, the City has continued to invest in designing, rehabilitating, and constructing streets to continue to support commuters into, out of, and through the area. The two primary capital improvement projects that have been completed in the last 10 years were Royder Road Rehabilitation Phases 1-3 and Greens Prairie Trail Phases 1-3. The Royder Road Rehabilitation project included the realignment and widening of the road from the north of Backwater Drive to Wellborn Road which reclassified the road as a major collector with sidewalks and bike lanes on both sides of the road. This project was largely in response to Wellborn Middle School, Greens Prairie Elementary School, and Pecan Trail Intermediate School being built and increasing the amount of traffic flow in the area. The Greens Prairie Trail (now Greens Prairie Road) project widened the road to a 4 Lane Minor Arterial with bike lanes and sidewalks. These projects directly achieved the Wellborn Community Plan’s action items M1.2, M8.2, M2.2, and M3.1 which state that road improvements, such as road maintenance and rehabilitation, be made for Greens Prairie Road, Greens Prairie Road W, Royder Road, and Victoria Avenue. Other projects pursued under these action items include road improvements on McCullough Road, Church Street, Madison Street, and Live Oak Street, in which the City provided preventative road maintenance to the street pavement that included lane stripes and bicycle markers for a protected bike lane. Economic Indicators The development in the area has primarily been residential, but the area has seen some commercial growth as well. According to the data provided by the ESRI Living Atlas, the district currently contains approximately 55 different businesses and employs 377 individuals which equates to roughly 7 employees per business. That is considerably lower than the city’s overall average of 12.5 employees per business. Property ownership stability is an important indicator of how frequently new people or businesses are occupying the area. Of the 279 properties, 120, or 43%, were owned by the same entity in 2017 and 2022. Of those properties, 42, or 15%, were owned by the same entity in 2012 and 2022. This data shows that more than 80% of properties changed hands in the past 10 years, indicating a significant turnover in property ownership and change within the district. Mobility STREETS The Thoroughfare Plan within the City’s Comprehensive Plan details the location and size of existing and future major roadways throughout College Station. It is based on the projected traffic demand resulting from the anticipated growth in population and employment and is guided by the Future Land Use & Character Map. It includes the location of streets which may need to be constructed, extended, or improved and the number of lanes for each thoroughfare in the system. Functional classifications for thoroughfares differentiate the number of vehicles they are anticipated to accommodate and the number of lanes that are required. In the Wellborn Community Plan, action item M1.1 specified removing several streets from the Thoroughfare Plan to further retain the rural characteristics of the community. This is now reflected in the current classifications of thoroughfares within the district. Page 168 of 206 42CSTX.GOV | WELLBORN DISTRICT PLAN The highest classification road within the district is Wellborn Road (FM 2154), which is a future 4 Lane Major Arterial that runs along the Union Pacific Railroad. Greens Prairie Road is a partially constructed existing 4 Lane Minor Arterial between Wellborn Road and Royder Road. The remaining section to be improved was approved on the 2022 Brazos County Bond Proposition A and is anticipated to be complete within the next five years. Royder Road is also a future 4 Lane Minor Arterial. Victoria Avenue is a proposed 2 Lane Major Collector and Creek Meadow Boulevard North is an existing 2 Lane Minor Collector. Three streets within the district are proposed 2 Lane Minor Collectors: McCullough Road, Live Oak Street, and South Dowling Road. BICYCLES In conjunction with the Comprehensive Plan, the Bicycle, Pedestrian, and Greenways Master Plan works to expand the bicycle and pedestrian network through the development of facilities on new and rehabilitated streets, off-street shared-use paths, and along the city’s greenways. There are currently 0.7 miles of existing bike lanes within the district. The Bicycle, Pedestrian, and Greenways Master Plan calls for an additional 2.2 miles of proposed bike facilities and 0.5 miles of proposed bike routes. There are currently bike racks provided in four different locations across the district, including Wellborn Middle School, the Magruder Office, TDI Brooks International Lab, and Wellborn Business Park. There are also bike racks located at Pecan Trail Elementary School and within the Creek Meadows subdivision, though these are outside of the district boundary. SIDEWALKS There are currently roughly 2.4 miles of existing sidewalks within the district and 2.7 miles that are proposed to be developed in the future. Similar to decreasing the intensity of the street classifications, the Wellborn Community Plan also called for the removal of proposed sidewalks within the Bicycle, Pedestrian, and Greenways Master Plan on McCullough Road, Greens Prairie Road West, I&GN Road, and South Dowling Road. During the public engagement for the Wellborn Community Plan, residents mentioned the desire to maintain rural open ditch section roads, arguing that sidewalks did not reflect the rural character they desired. These changes were ultimately incorporated into the Bicycle, Pedestrian, and Greenways Master Plan. Page 169 of 206 [INSERT 11X17 THOROUGHFARE PLAN MAP] Existing Thoroughfare Plan FREEWAY/EXPRESSWAY PROPOSED FREEWAY/EXPRESSWAY LANEMAJOR ARTERIAL PROPOSEDL ANEMAJOR ARTERIAL LANEMAJOR ARTERIAL PROPOSEDL ANEMAJOR ARTERIAL MINOR ARTERIAL PROPOSED MINOR ARTERIAL MAJORCOLLECTOR PROPOSEDMAJOR COLLECTOR MINORCOLLECTOR PROPOSED MINORCOLLECTORFM 2154FM 2154RO Y D E R R D RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D RO Y D E R R DFM 2154RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJ MAP A.5 Page 170 of 206 [INSERT 11X17 BICYCLE PLAN MAP] Existing Bicycle Plan BIKE LANE EXISTING BIKE LANE FUNDED BIKE FACILITY PROPOSED BIKE ROUTE EXISTING BIKE ROUTE PROPOSED SHARED-USE PATH EXISTING SHARED-USE PATH FUNDED SHARED-USE PATH PROPOSED GRADE SEPARATION EXISTING GRADE SEPARATION FUNDED GRADE SEPARATION PROPOSED DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJFM 2154FM 2154 RO Y D E R R D RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLING RDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEETT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154 RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLING RD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWET D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D MAP A.6 Page 171 of 206 [INSERT 11X17 PEDESTRIAN PLAN MAP] Existing Pedestrian Plan SIDEWALK EXISTING SIDEWALK FUNDED SIDEWALK PROPOSED SHARED-USE PATH EXISTING SHARED-USE PATH FUNDED SHARED-USE PATH PROPOSED GRADE SEPARATION EXISTING GRADE SEPARATION FUNDED GRADE SEPARATION PROPOSED DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJFM 2154FM 2154R O Y D E R R D R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEETT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD RO Y D E R R D RO Y D E R R DFM 2154R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWET D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD RO Y D E R R D MAP A.7 Page 172 of 206 46CSTX.GOV | WELLBORN DISTRICT PLAN TRANSIT Neither Brazos Transit District nor Texas A&M University Transportation Services offer transit service in the Wellborn District. College Station Independent School District has bus routes serving students who live in the neighborhoods that feed into their schools. Residents in the Wellborn District depend heavily on personal automobiles to navigate around the area and the city. CRASH DATA Over the last 10 years, there have been 154 vehicular crashes within the district. Out of these, 147, or 95%, were indicated to be minor crashes and either had no injuries, suspected minor injuries, or possible injuries. Of the crashes, 105, or 68%, occurred on Wellborn Road (FM 2154), the largest thoroughfare in the district. Page 173 of 206 [INSERT 11X17 CRASH DENSITY MAP] CRASH DENSITY* MID HIGHLOW 1 FM 2154 & S DOWLING RD 2 FM 2154 & CHURCH ST 3 VICTORIA AVE & ROYDER RD 4 FM 2154 & VICTORIA AVE 5 FM 2154 & BETWEEN MCCULLOUGH RD & BARRON CUT-OFF RD Crash Density TOP 5 INTERSECTIONS WITH CRASHES Crash data collected by the College Station Police Department from 2012- 2022 was used to map tra ic accidents spanning all modes of transportation. *Based on the number of crashes within a 250 foot radius 1 2 34 5 FM 2154FM 2154RO Y D E R R D RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJ MAP A.8 Page 174 of 206 48CSTX.GOV | WELLBORN DISTRICT PLAN Utilities The Wellborn district is served by College Station Utilities (CSU), Bryan Texas Utilities (BTU), and Wellborn Special Utilities District (Wellborn SUD), depending on the utility and property location. Wellborn SUD provides water service, CSU provides wastewater service to approximately 9% of the district, and BTU provides electric service for the area. Outside of the CSU wastewater service boundary specified by the Certificate of Convenience and Necessity (CCN), most residents in the district are on septic systems. The district is limited in what types of developments it can sufficiently support due to various utility constraints. Wastewater capacity is a primary limiting factor since most developments are not connected to the City’s sewer system and must maintain a 1-acre or greater lot size for septic system requirements. All development proposals in the Wellborn District must get approvals from the applicable providers before they can begin development. Staff from all three organizations have and will continue to share information pertinent to utility provision and utility planning within the district. Floodplain While there is no FEMA-identified floodplain within the district, there are several tributaries throughout the area providing natural drainage as part of the Peach Creek Drainage Basin. Further research and identification studies are needed to determine precise floodplain boundaries in the district. Conclusion Analyzing the current conditions of the Wellborn District provides context for the plan update process. This data supports and informs residents, participants, and City staff to guide the decisions made when envisioning the future of the Wellborn District. The existing conditions of this district largely reflect the implementation of the original Wellborn Community Plan which has helped maintain the rural character of the area. This includes limited sidewalks connecting community areas, decreasing the functional classifications of some thoroughfares, and creating Wellborn-specific zoning districts, all of which aid in maintaining the rural character and feel of the Wellborn area. This planning effort should be intentional to guide the next decade of development and build on past successes by anticipating and guiding growth pressures and identifying additional ways to embrace the spirit of Wellborn. Page 175 of 206 [INSERT 11X17 WATER SERVICE AREAS MAP] Water Service Areas FM 2154FM 2154 R O Y D E R R D R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD RO Y D E R R D RO Y D E R R DFM 2154 R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD RO Y D E R R D DISTRICT BOUNDARY COLLEGE STATION WATER WELLBORN SUD MAP A.9 Page 176 of 206 [INSERT 11X17 WASTEWATER SERVICE AREAS MAP] Wastewater Service Areas FM 2154FM 2154 R O Y D E R R D R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEETT D R D R EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD RO Y D E R R D RO Y D E R R DFM 2154 R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWET D R E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD RO Y D E R R D COLLEGE STATION WASTEWATER DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJ M AP A.10 Page 177 of 206 [INSERT 11X17 ELECTRIC SERVICE MAP] Electric Service Areas FM 2154FM 2154 RO Y D E R R D RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLING RDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTON E D R CAPSTON E D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEE TT DRDR EE WW AA T E R T E R CREEKCREEKMEAMEADDOWOW BLVDBLVD NN CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154 RO Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLING RD BARRON CUT-OFF RDCAPSTON E D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWE T DR E W A T E R CREEKMEADOW BLVD N CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D DISTRICT BOUNDARY COLLEGE STATION UTILITIES (CSU) BRYAN TEXAS UTILITIES (BTU) MAP A.11 Page 178 of 206 [INSERT 11X17 FLOODPLAIN MAP] Floodplain FLOODPLAIN RIVERS & STREAMS FM 2154FM 2154R O Y D E R R D R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDKOPPE BRIDGE RDMCCULMCCULLOUGH RDLOUGH RDVICTORIA AVEVICTORIA AVEGREENS PRAIRIE RDGREENS PRAIRIE RDW O O D L A K E D R W O O D L A K E D R SS DODOWLINGWLINGRDRD BARRON CUT-OFF RDBARRON CUT-OFF RDCAPSTONE D R CAPSTONE D R W S P H I L L I P S P K W Y W S P H I L L I P S P K W Y ET O N B U R Y A V E ET O N B U R Y A V E SWSWEETT D R D R EE WW AA T E R T E R CHURCHURCHCH STST VICTORIA AVEVICTORIA AVECACASTLESTLEGGATEATEDD RR PORTLAND AVEPORTLAND AVEFM 2154FM 2154I&GN RD I&GN RD R O Y D E R R D R O Y D E R R DFM 2154R O Y D E R R D GREENS PRAIRIE RDGREENS PRAIRIE RDKOPPE BRIDGE RDMCCULLOUGH RDVICTORIA AVEGREENS PRAIRIE RDW O O D L A K E D R S DOWLINGRD BARRON CUT-OFF RDCAPSTONE D R W S P H I L L I P S P K W Y ET O N B U R Y A V E SWET D R E W A T E R CHURCH ST VICTORIA AVECASTLEGATED R PORTLAND AVEFM 2154I&GN RD R O Y D E R R D MINTERBRANCHTRIBUTARY4 SPRI NGCREEKTRIBUTARY7.1HO PESCREEKH OPESCREEK T RI B UTA RY10.1 HOPESCRE E K T R IB U T A R Y 3.3S P RINGCREEK P EACH CREEK S OUTH T R IB U T ARY24 SPRINGCREEKTRIBUTARY7PEAC H CREEK S OUTH T RI BUTARY25PEACHCREEK SO UTHTR I BUTAR Y 22P E A CHCRE EKSOUTH TRIBUTARY 18PEACHCREEKSOUT HTRIBUTA R Y16.6HOPESCR EEK T RIBUTARY10PEACHCREEKSOUTH TRIBUT A R Y 16.4HOPESCREEK TRIBU T A R Y 3PEACHCREEKS OUT HT RIBUTARY20PEACHCREEKSOUTH DISTRICT BOUNDARY COLLEGE STATION CITY LIMITS COLLEGE STATION ETJ M AP A.12 Page 179 of 206 53CSTX.GOV | WELLBORN DISTRICT PLAN APPENDIX B: PUBLIC ENGAGEMENT SUMMARY Public participation and input are critical to any planning effort. The knowledge and experience of residents help City staff understand the concerns of the community and adjust the plan accordingly. The City of College Station places a high priority on receiving and responding to resident feedback; to that end, City staff offered numerous engagement opportunities in various formats to empower everyone to have their voices heard. The following describes those opportunities and summarizes the public feedback. Page 180 of 206 54CSTX.GOV | WELLBORN DISTRICT PLAN WORKING GROUP MEETING – JANUARY 18, 2023 After compiling the existing conditions data, the Working Group held its kick-off meeting to discuss the project, lessons learned from the Wellborn Community Plan, and goals for the new planning effort. This meeting included a community listening session, which gave City staff a good jumping off point for the entire planning effort. AREA-WIDE MEETING – JANUARY 24, 2023 Before this meeting, City staff mailed fliers to property and business owners within the planning area with details for this meeting along with future meetings on February 28, March 21 (virtual meeting), and May 30. This first area-wide meeting centered on defining the scope of the project and continued the community listening session from the January 18 Working Group meeting. VIRTUAL ENGAGEMENT SITE – FEBRUARY TO JUNE 2023 In addition to the in-person meetings, staff offered numerous opportunities to provide feedback throughout the planning effort. The site launched with more information on the timeline of the planning effort, ideas on goals from the first phase meetings, and a map where individuals could provide ideas, things they liked, and things they wanted to see changed. The virtual engagement site also hosted a comment map for the proposed changes to the Thoroughfare Plan and Bicycle, Pedestrian, and Greenways Master Plan. WORKING GROUP MEETING – FEBRUARY 15, 2023 The Working Group met to discuss the feedback City staff received from the January 18 and 24 meetings. One of the main themes from the listening session was maintaining a rural character. In an effort to clarify that concept, the Working Group identified specific characteristics and land uses that would help to keep Wellborn rural. AREA-WIDE MEETING – FEBRUARY 28, 2023 Building upon the feedback from the February 15 meeting, City staff led participants in the same activities to identify the rural character and where different land uses should be located to achieve the goals of the community. The results of this meeting and the February 15 meeting were, among other things, used to establish the proposed changes to the Comprehensive Plan’s Future Land Use & Character Map, Thoroughfare Plan, and the bicycle and pedestrian maps within the Bicycle, Pedestrian, and Greenways Master Plan. VIRTUAL AREA-WIDE MEETING – MARCH 21, 2023 The virtual area-wide meeting focused on gathering feedback on the plan goals and actions from people who may not have been able to make it to the previous meetings. Incorporating the feedback from the virtual meeting and all of the previous meetings, staff began drafting the plan actions. Page 181 of 206 55CSTX.GOV | WELLBORN DISTRICT PLAN COMBINED WORKING GROUP & AREA-WIDE MEETING – APRIL 12, 2023 At the first meeting of the planning effort, several questions were asked and concerns raised, about various infrastructure components, including sewer capacity, roadway capacity, and the FM 2154 (Wellborn Road) widening project. To address those concerns, staff from the City of College Station Water Services and Capital Improvements departments and representatives from the Texas Department of Transportation presented on infrastructure capacity and any planned improvements. Planning & Development Services staff were present to facilitate the meeting and receive community feedback. WORKING GROUP MEETING – MAY 16, 2023 City staff presented proposed changes to the Comprehensive Plan Future Land Use & Character Map, Thoroughfare Plan, and the bicycle and pedestrian maps within the Bicycle, Pedestrian, and Greenways Master Plan based on the feedback received throughout the planning process and received feedback from the Working Group. AREA-WIDE MEETING – MAY 30, 2022 After incorporating the comments from the May 16 Working Group meeting, City staff presented proposed changes to the Comprehensive Plan Future Land Use & Character Map, Thoroughfare Plan, and the bicycle and pedestrian maps within the Bicycle, Pedestrian, and Greenways Master Plan. Following this meeting, staff collated feedback from the previous phases of the planning effort and worked to write the Wellborn District Plan. Participant responses were incorporated into the plan before it was finalized. WORKING GROUP MEETING – AUGUST 23, 2023 The Working Group met before the Wellborn District Plan was finalized to discuss and finalize the plan actions prior to the final area-wide meeting. AREA-WIDE MEETING – AUGUST 30, 2023 After finishing the Wellborn District Plan, City staff organized a final area-wide meeting to ensure the plan matched the vision of the community and gather any final suggestions or edits before bringing the plan forward for adoption. Page 182 of 206 56CSTX.GOV | WELLBORN DISTRICT PLAN Thank you to the following individuals and groups who contributed to the preparation of the Wellborn District Plan. WELLBORN WORKING GROUP Acknowledgements David L. Alexander Elizabeth Appleby Dan Casey Jane Cohen Robert Cohen Barry Creighton Barry Ely Mark Feldhake Tim Foster Stephen Fuchs Jill George Robert Grabowsk Ryan Harrington Shelly Humphrey Kevin Kuklis D. Bradley Laauwe Shauna Laauwe Jeff Lehde Richard Lynn Thomas Marty Mike McCleary Dan McMillan Erik Moratzka William Murphy Bert Nitzke Rabevra Ofczarzak Gitta M Pap Casey Richardson Ervin Richardson Lynn Ruoff Bob Ruth Kathy Scott William Scott, Layla Hensarling Wright Tony Watson Tim Wolff Edward Wren Larry Young CITY COUNCIL John Nichols, Mayor Mark Smith, Place 1 William Wright, Place 2 Linda Harvell, Place 3 Elizabeth Cunha, Place 4 Bob Yancy, Place 5 Dennis Maloney, Place 6 PLANNING & ZONING COMMISSION Dennis Christiansen, Chairperson Marcus Chaloupka Aron Collins Jason Cornelius Melissa McIlhaney Bobby Mirza David White Page 183 of 206 57CSTX.GOV | WELLBORN DISTRICT PLAN ADMINISTRATION Bryan Woods, City Manager Jeff Capps, Deputy City Manager Jeff Kersten, Assistant City Manager Jennifer Prochazka, Assistant City Manager PLANNING & DEVELOPMENT SERVICES Michael Ostrowski, CEcD, AICP, Director Molly Hitchcock, AICP, Assistant Director Alyssa Halle-Schramm, AICP, LEED GA, Long Range Planning Administrator Naomi Sing, Staff Planner – Project Manager Carl Ahrens, Transportation & Mobility Planner Anthony Armstrong, P.E., CFM, Land Development Review Administrator Katherine Beaman-Jamael, Graduate Transportation & Mobility Engineer Samantha Beckman, Planning Intern Brian Binford, CBO, Building Official Erika Bridges, P.E., CFM, Assistant City Engineer Carol Cotter, P.E., CFM, City Engineer Matthew Ellis, AICP, Senior Planner Crystal Fails, Staff Assistant David Hahn, GIS Technician Lucas Harper, P.E., Civil Engineer Kristen Hejny, Administrative Support Specialist Ashley Klein, Planning Intern Robin Macias, Staff Planner Aspen Pflanz, Transportation & Mobility Planner Elise Sawyer, GIS Intern Gabriel Schrum, Staff Planner Jason Schubert, AICP, Transportation Planning Coordinator Gillian Sitler, Graduate Civil Engineer Julie Svetlik, CFM, GIS Analyst Bryce Trujillo, Assistant Building Official Page 184 of 206 58CSTX.GOV | WELLBORN DISTRICT PLAN STAFF RESOURCE TEAM Jennifer Cain, Director of Capital Improvement Projects Timothy Crabb, Director of Electric Utility Debbie Eller, Director of Community Services Emily Fisher, Director of Public Works Theo Garcia, Civil Engineer, Water Services Alan Gibbs, Assistant Director of Water Services Randall Lewis, Assistant Director of Electric Utility Emily Lopez, Graduate Civil Engineer, Water Services Stephen Maldonado Jr., Assistant Director of Water Services Ramiro Martinez, Engineering Operations Manager, Water Services Rachel Mayor, Multimedia Manager Gary Mechler, Director of Water Services Barbara Moore, Assistant to the City Manager Brian Piscacek, Assistant Director of Economic Development & Tourism Gustavo Roman, Assistant Director of Community Services Natalie Ruiz, Director of Economic Development & Tourism Debbie Stickles, Electric Design Supervisor, Electric Utility Lucero Valenzuela, Multimedia Coordinator Page 185 of 206 59CSTX.GOV | WELLBORN DISTRICT PLAN Contributors to the 2013 Wellborn Community Plan WELLBORN RESOURCE TEAM David Alexander, Jane Cohen, Renee Evans, Walter Evans, Bob Fountain, Carol Fountain, Keith Franze, David Gerling, Patricia Gerling, Darren Hartl, Linda Hale, Dale Holocek, Mary Ann Nagyvary, Alton Ofczarzak, Rich Risbon, Sydney Risbon, Lynn Ruoff, Elizabeth Terry, Kristin Schaefer, Craig Hall (Planning & Zoning Commission representative), and Mike Ashfield (Planning & Zoning Commission representative) PLANNING & ZONING COMMISSION Matt Robinson, Bob Cowell, Molly Hitchcock, Lauren Hovde, Venessa Garza, Kristen Hejny, Mandi Alford, Joe Guerra, Barbara Moore, and Jenifer Paz Page 186 of 206 cstx.gov Page 187 of 206 M AP 6.3 Functional Classification & Context Class UNIVERSITY DRUNIVERSITY DRGEORGE BUSH DRGEORGE BUSH DRSOUT H WEST SOUT H WEST PKWYPKWYFM 281 8 FM 281 8 TE X A S A V E S TE X A S A V E S F M 2 1 5 4 F M 2 1 5 4 SH 6 S SH 6 SHARVEY RDHARVEY RDGRAHAM RDGRAHAM RDBARRON RDBARRON RDHOL LEMAN DR SHOL LEMAN DR S SH 6 S SH 6 SWILLIAM D. FITCH PKWYWILLIAM D. FITCH PKWYROCKROCKPRAIRIEPRAIRIE RDRD GREENS PRAIRIE RDGREENS PRAIRIE RDHWY 30 FM 2 1 5 4 FM 2 1 5 4FM 60FM 60MINOR COLLECTOR MAJOR COLLECTOR MINOR ARTERIAL 4 LANE MAJOR ARTERIAL 6 LANE MAJOR ARTERIAL FREEWAY/EXPRESSWAY GRADE SEPARATION THOROUGHFARE PLAN URBAN CORE GENERAL URBAN SUBURBAN RURAL CONTEXT ZONES CITY LIMITS ETJ BRYANBRYAN Page 188 of 206 BRYAN TEXASAVSGEORGEBUSHDRTEX A S A V WE L L B O R N R DUNIVERSITY DRH A R VEYM ITC HELLPWSVIC T O R I A A V E29THST WELSHAV WILLIAM D FITCH PWLINCOLN AVHOLLEMANDRUNIVERSITYDREBOONVILLERD SOUTHWESTPW N H A R V E Y M I T C H E L L P W STEXASAV BARRONRDHARVEYRDEVILLAMARIARDWVILLAMARIARDFM 21 5 4TARROW ST HOLLEMA N DRECAVITTAV ANDERSONST HOLLEMANDRWLEONARD RDDARTMOUTH S TGROESBECKSTE A R L R U D D E R F W SBRIARCREST DRS CO LLE GE AV RAYMONDSTOTZERPWWSH21 N E A R L R U D D E R F W GEORGEBUSHDRWFINFEATHERRDROCKPRAIRIERD C A P S T O N E D R SH 6 SGREENS PRAIRIE RDFM 2 1 5 4HARV EYMITCHELLPW S RIVERSIDEPW S H 6 S SH 30 FM158 SH 6 S WILLIAM D FITCH PWRIVERSIDEPW RAYMONDSTOTZERPWMAP 2.6 Proposed Bicycle FacilitiesMAP 5.4 GU L F S T A T E S U T I L I T I E S E A S E M E N T Multi-use Path Proposed Grade Separation Existing Grade Separation Funded Grade Separation Proposed Brazos County College Station City Limits Easterwood Airport CSISD Property Texas A&M University Property College Station Parks College Station Greenway CSISD Schools Brazos Streets Bike Route Proposed Bike Route Existing Bike Lane Funded Bike Lane Existing 0 10.5 Miles Bike Facility Proposed Multi-use Path Existing Multi-use Path Funded College Station ETJ Page 189 of 206 BRYAN GU L F S T A T E S U T I L I T I E S E A S E M E N T TEXASAVSGEORGEBUSHDRTEX A S A V WE L L B O R N R DUNIVERSITY DRH ARVEYMITCH ELLPWSVIC T O R I A A V E 2 9 THST WELSHAV WIL LI A M DFITCHPWLINCOLN AVHOLLEMANDRUNIVERSITYDREBOONVILLERD SOUTHWESTPW N H A R V E Y M I T C H E L L P W STEXASAV BARRONRDHARVEYRDWVILLAMARIARDTARROWSTHOLLE M A N DRECAVITTAV ANDERSONST HOLLEMANDRWLEONARD RDDARTMOUT H S TSOUTHWEST PW EE VILLAMARI ARDE A RL R U D D E R F W SGROESBECKST FM 2 1 5 4 S COLLE G E AV RAYMONDSTOTZERPWW SH 21N E A R L R U D D E R F W GEORGEBUSHDRWFINFEATHERRDROCKPRAIRIERD C A P S T O N E D R SH 6 SGREENS PRAIRIE RDFM 2 1 5 4 H A R VEY MITCHELLPW S RIVERSIDEPW S H 6 S SH 30 FM158 SH 6 S WILLIAM D FITCH PWRAYMONDSTOTZERPWProposed Pedestrian FacilitiesMAP 5.5 Sidewalk Existing Sidewalk Funded Sidewalk Proposed Multi-use Path Proposed Grade Separation Existing Grade Separation Funded Grade Separation Proposed Brazos County College Station City Limit Texas A&M University Property Easterwood Airport CSISD Property College Station Parks College Station Greenway CSISD Schools Brazos Streets 0 10.5 Miles College Station ETJ Multi-use Path Existing Multi-use Path Funded Page 190 of 206 September 18, 2023 Item No. 3.4. Planning and Development Services Department's Plan of Work Sponsor: Michael Ostrowski, Director of Planning and Development Reviewed By CBC: N/A Agenda Caption: Presentation, discussion, and possible action on the Planning and Development Services Department's Plan of Work. Relationship to Strategic Goals: • Good Governance • Financial Sustainability • Core Services & Infrastructure • Neighborhood Integrity • Diverse & Growing Economy • Improving Mobility • Sustainable City Recommendation(s): To receive the presentation and provide direction to staff. Summary: Every year the Planning and Development Services Department creates a plan of work that is approved by the Planning and Zoning Commission. The plan of work identifies the items that the department will work on during the year. By establishing a plan of work, it helps the department prioritize which projects they will undertake, as well as identify the resources it will take, both in terms of staff capacity and budget. The plan of work is established for each fiscal year (October - September), but projects may take multiple years to complete. There are times when additional projects get added throughout the year. However, this can have an impact on completing other projects on the plan of work. Given the number of projects that relate to transportation and mobility, both in the current and proposed plan of work, staff sought the input of the Board at last month's meeting. Enclosed is the proposed FY2024 Plan of Work for the Board's recommendation to the Planning and Zoning Commission. All of the projects in the current FY2023 Plan of Work will carry over to the FY2024 Plan of Work. Budget & Financial Summary: N/A Attachments: 1. PDS Plan of Work FY2023 2. PDS Plan of Work FY2024 Page 191 of 206 MultiPlan View Report 2023-09-14 - 12:53:15PM CDT 1 of 2 Name Description Status Start Date Due Date Last Comment Bicycle, Pedestrian, and Greenways Master Plan Audit This audit will evaluate the implementation and status of actions contained in the Bicycle, Pedestrian, and Greenways Master Plan that was originally adopted in 2010 and had a significant update in 2018. On Track 06/12/2023 09/30/2023 The data-gathering and verification for the audit is wrapping up this week. The text of the audit should be ready to review for PDS staff next week, and then the draft will be sent to PubComm to format similarly to the Small Area Plans Audit report. The final report will be ready to send to the BPG Board in their October 18th agenda packet. Bike Lane and Improvements Analysis Analyze roadways to determine prime candidates for the addition of bike lanes and/or improvements such as separated bike lanes. Not Started 05/01/2023 09/30/2023 This project is being consolidated with the grant application for the Complete Streets Plan for Core of College Station which will start in FY 24 if awarded. If not awarded, will proceed with lesser internal effort. Existing conditions and data collection have been broken out into a separate project. Bryan / College Station Unified Design GuidelinesUpdate These guidelines serve as a technical resource for the design and construction of activities in the rights-of-way or easements. This project involves updates to various portions of the guidelines. Off Track 10/01/2022 07/31/2024 Consultant under contract to update Standard Details. Wrapping up revisions to Phase 2 Guidelines and Specifications. Census 2020 Follow Up Monitor Census 2020 data releases from the US Census Bureau. Once data is available, update population figures and projections, identify data trends and conduct analysis. Off Track 08/14/2023 09/30/2023 The 2020 Census Detailed DHC-A dataset will be released on September 21, 2023. This dataset provides population counts and sex by age statistics for approximately 1,500 detailed racial and ethnic groups. Data will be available for the nation, states, counties, places (cities and towns), census tracts, and American Indian/Alaska Native/Native Hawaiian (AIANNH) areas. The Detailed DHC-B will follow, with no set date at this time, and it will add tenure information for racial and ethnic groups. The next data release from the American Community Survey (ACS) is December 2023 for the 2022 ACS dataset. Following that release, staff in the Planning division will begin to incorporate the various Census, ACS, and internal datasets into an existing conditions report in 2024 that will proceed the 5-year Comprehensive Plan update in 2025. City-Initiated Rezoning to MH Middle Housing Identify and rezone properties to MH Middle Housing. On Track 03/01/2023 01/31/2024 The areas for the City-Initiated rezoning cases have been finalized. To address the public input and concerns about shared housing uses during the summer input sessions, staff have proposed creating the HOO High Occupancy Overlay and removing shared housing from the MH Middle Housing zoning district. Based on the context of each area and public input, the City-Initiated cases have been designated as either appropriate for the HOO High Occupancy Overlay and MH Middle Housing, or only MH Middle Housing. All cases (27 in total) from the current phase are scheduled for the October 5 Planning & Zoning Commission meeting and the October 12 City Council meeting for their consideration and possible approval. The areas in future phases will continue through 2023 and into 2024, as surveying work is needed for those areas. Dashboard - Demographics Creation of a dashboard for demographic statistics using ArcGIS Hub.On Track 04/01/2023 09/30/2023 The demographics dashboard has been created and refined as of summer 2023. Staff are now working to house the dashboard on the Planning & Development Services website as a temporary digital location before a larger dashboard hub is created by IT in FY24. Those changes are expected in October. Dashboard - Permits Creation of a dashboard for permit statistics using ArcGIS Hub to replace the development newsletter.On Track 04/01/2023 09/30/2023 The permits dashboard has been created and refined as of summer 2023. Staff are now working to house the dashboard on the Planning & Development Services website as a temporary digital location before a larger dashboard hub is created by IT in FY24. Those changes are expected in October. Identify and Secure Funding Sources for UrbanHeat Islands Plan Identify and Secure Funding Sources for Urban Heat Islands Plan On Track 01/01/2023 12/31/2023 Staff has secured grant funds from TAMU for two parks, and is also working with Community Services on CDBG Entitlement funding for others. General fund dollars were not allocated for this project for FY2024. Implement Complete Street and Context SensitiveDesign Amend the street cross sections and update the Unified Development Ordinance, the Bryan-College Station Unified Design Guidelines, and the City’s capital improvement process to implement context sensitive and complete street design such as prioritized mode corridors, reconstruction projects in established neighborhoods, and in areas where right-of-way is constrained. On Track 10/01/2022 10/31/2023 Finalizing proposed thoroughfare cross sections and design elements from consultant. Once completed, will proceed with adopted updated cross sections into Comprehensive Plan in fall 2023. Land Use Fiscal Analysis Prepare a land use fiscal analysis based on the Comprehensive Plan to determine the needed amount of specific land uses and whether that amount matches the Future Land Use & Character Map. From there, conduct a fiscal analysis based on the amount of land uses, and the cost to serve those land uses compared to the anticipated revenue generated from them. Off Track 07/01/2023 06/30/2024 The request for proposals has been drafted and proposals are due September 12, 2023. Staff will then analyze proposals and select a consultant to assist with the project. Options to Preserve Integrity of Neighborhoods Identify and analyze options that are intended to preserve the integrity of neighborhoods.Achieved 10/01/2022 12/31/2022 Staff presented options to the City Council in April 2022, where direction was given. Staff then moved forward with creating a definition for Shared Housing that differentiated these types of uses from Single-Family. Small Area Plan - Northeast GatewayRedevelopment Plan From the 10-Year Update to the City’s Comprehensive Plan, this project is to create a small area redevelopment plan for the general area surrounding Texas Avenue and University Drive. This project was recently rebranded the Northeast Gateway Redevelopment Plan. On Track 10/01/2022 10/31/2023 This planning effort remains on track. Public review of the full draft plan is planned for the coming weeks, with plan adoption to follow on September 28. Statuses Not Started 1 (4%)On Track 11 (48%) Achieved 6 (26%) Off Track 5 (22%) Due Dates Not Past Due 17(100%)Past Due 0 (0%) Progress Updates Up-to-Date 20 (87%)Late 3 (13%) Pending 0 (0%) Page 192 of 206 MultiPlan View Report 2023-09-14 - 12:53:15PM CDT 2 of 2 Name Description Status Start Date Due Date Last Comment Small Area Plan - Wellborn District Plan Update The Wellborn Community Plan was adopted by City Council on April 25, 2013. The planning area is located in the southwestern portion of the City and includes much of the remaining historic Wellborn Community. Since 2013, several changes have occurred, as well as market conditions. Upon the completion of the Neighborhood Plan Audit project, staff will update this plan. On Track 10/01/2022 10/12/2023 The Wellborn District Plan Update is on track. Staff held the final Working Group and area-wide meetings on August 23 and August 30, respectively. The finalized plan is posted to cstx.gov/Wellborn and is moving through the plan adoption process. It will be reviewed and potentially recommended by the Bicycle, Pedestrian, and Greenways Advisory Board on September 18 and the Planning & Zoning Commission on October 5. The City Council will review and potentially adopt the plan at their October 12, 2023 meeting. Strategic Plan for Customer ServiceEnhancements Creation of a strategic plan to identify actions to improve customer service from the department.On Track 05/01/2023 09/30/2024 Twelve of the fourteen components of the plan have been discussed, brainstormed, and/or researched. Enough information has been gathered to begin drafting the plan. Discussions and research will continue on the last two components while the Action Plan is being drafted. Traffic Congestion and Mobility Analysis Establish performance metrics to create an annual traffic congestion and mobility report, context-sensitive congestion maps, and a congestion mitigation toolkit document that includes travel demand management techniques, policy recommendations, traffic data tools, construction projects, and operational management methods. On Track 07/01/2023 06/30/2024 Bids received on 9/7/23. Review committee to meet to evaluate bid responses. Unified Development Ordinance Amendment -Clean-Up and Consistency Clean-up items relating to the Unified Development Ordinance.Achieved 04/01/2023 08/31/2023 Council adopted Ordinance 2023-4453 on August 10, 2023. Unified Development Ordinance Amendment -Creation of Middle Housing Zoning District Adopt an ordinance to create a "middle housing" zoning district, following the Comprehensive Plan update, to implement the new Mixed Residential land use category. Achieved 10/01/2022 12/31/2022 Ordinance was adopted by the City Council on 10/27/2022. Unified Development Ordinance Amendment - Lot-by-Lot Grading Determine whether the City should require a grading plan for individual lot developments.Achieved 01/01/2023 06/30/2023 The ordinance was adopted at June 12, 2023 City Council meeting. Unified Development Ordinance Amendment - Off- Street Parking Requirements Explore the option of reducing or eliminating off- street parking requirements for certain uses and/or areas. Achieved 10/01/2022 08/30/2023 The City Council approved the ordinance amendment on August 10, 2023. Unified Development Ordinance Amendment - Signs Review and update the City’s sign ordinance in light of the recent Supreme Court decisions regarding sign regulations based upon content and off-premise. Off Track 06/01/2023 09/30/2023 Redrafted with UDO clean up version. Redrafting portions after attending ISA Sign Research Foundation webinar on 6/28. Unified Development Ordinance Amendment -Sustainable Landscaping / Yards Analyze and make modifications to landscaping requirements within City ordinances to ensure that sustainable practices are allowed and encouraged. Off Track 01/01/2023 09/30/2023 Staff is currently analyzing potential amendments. The scope has changed from just sustainable landscaping in yards to potentially other areas, as well as what requirements need to be submitted as part of a landscape plan. Update City Bicycle Map Update the City's bicycle map to incorporate recent changes in facilities, as well as to enhance usability. On Track 06/01/2023 09/30/2023 GIS is continuing updating the layers on the map. Anticipating an October completion date. Urban Heat Island Mitigation Plan Develop a five-year planting plan to mitigate some of the effects of the urban heat island.Achieved 10/01/2022 12/31/2022 The City Council accepted the "Cooling" College Station plan in September of 2022. The next project involved with the plan is to identify funding opportunities to implement the plan. Page 193 of 206 MultiPlan View Report 2023-09-14 - 12:59:28PM CDT 1 of 1 Name Description ArcGIS Hub Page Creation of a ArcGIS Hub page to host all GIS mapping information. This project will be completed in tandem with the PDS GIS division and IT GIS. Bicycle Friendly Community DesignationApplication Submit application for Bike Friendly Community designation with intention becoming a silver level designation. Bicycle, Pedestrian, and Greenways Master Plan Implementation Implementation of actions identified within the Bicycle, Pedestrian, and Greenways Master Plan. An audit of the plan will be finished in fall 2023 which includes a review of actions completed. Prioritization of remaining actions will be undertaken and implemented. Complete Streets Plan for Core of College Station Development of plan to improve safety, connectivity, accessibility, and comfort of active transportation and transit users in the core of the City. Project is pending funding for consultant through TxDOT Transportation Alternatives grant program to be announced in October 2023. If grant is not awarded, a smaller effort will be performed by staff. Cost of Service Study Review the cost of service for all activities within the department to determine actual cost for administering those services. Dashboard - Bicycle and Pedestrian Creation of a dashboard for bicycle and pedestrian metrics using ArcGIS Hub. Digitize Historical Records Digitize all historical paper records. Establish Stakeholder Conversation Series Work with development community to establish a series of communications on various issues. This includes builders, developers, realtors, etc. Floodplain Hazard Assessment Assess the current floodplain hazards and assist in determining scale of any necessary mapping/remapping efforts. As part of the project, several of the City’s watersheds will be evaluated including Hopes and Peach Creeks where we have seen rapid growth in these mostly unstudied and unmapped watersheds and streams. International Building Codes (2024) Update Review and adoption of 2024 code cycle building codes. National Electrical Code (2023) Update Review and adopt the National Electrical Code 2023 edition and make needed amendments. Northeast Gateway Redevelopment Plan Implementation Implementation of actions identified within the Northeast Gateway Redevelopment Plan. The plan is slated for adoption in late September 2023. The actions to be implemented first will be identified after plan adoption, but are likely to include revisions to the Mixed-Use zoning district, among others. Ordinance Amendment - Curbside ManagementPolicy Ordinance amendment to create curbside management policy for ride-share services, transit, deliveries, curbside pick-ups, and food trucks and establishing designated aerial fire access locations. Ordinance Amendment - Flood for BCS DrainageDesign Guideline Update Amend Flood Ordinance to incorporate any revisions that arise from the BCS Drainage Design Guideline Update Ordinance Amendment - Flood for Community Rating System Requirements Amend Flood Ordinance to clarify applicability to replacement of manufactured homes in existing manufactured home developments. Ordinance Amendment - Safe Passing Evaluation and creation of a safe passing ordinance. Pedestrian Facility Design Complete Preliminary Engineering Report (PER) or schematic design for a high priority unfunded sidewalk and/or shared use path. Shared Use Path Design Standards Develop design guidelines for shared use paths to be incorporated into the BCS Unified Design Guidelines with UDO amendments as needed. Also includes design considerations for when paths cross at street intersections and at midblock locations. Small Area Plan Audit Phase 2 This audit will evaluate the implementation effectiveness of the older small area plans that have been adopted under the City's Comprehensive Plan. These small area plans include the Northgate District redevelopment plans (1996 and 2003), Wolf Pen Creek Master Plan (1998), and the Medical District Master Plan (2012). Strategic Plan for Customer ServiceImplementation Implementation of actions identified within the FY24 Customer Service Action Plan. The plan will be completed by 9/30/2023 and implementation will begin after that date. Tactical Urbanism Evaluate and develop tactical urbanism program. Transportation Existing Conditions and DataCollection Update GIS layers to include more detail and attributes of existing street pavement widths, bicycle and pedestrian infrastructure, and right-of-way. Also create a database of transportation-related volumes and other available data. Unfunded Bicycle and Pedestrian ProjectPrioritization Work with Bicycle, Pedestrian, and Greenways Advisory Board to update the metrics used to prioritize stand-alone unfunded bicycle and pedestrian-related infrastructure projects as identified in adopted City plans. Once the methodology is updated, perform the project prioritization to identify the higher priority projects to seek implementation from City and other funding sources. Unified Development Ordinance Amendment -Accessory Dwelling Units Amendments to the accessory dwelling unit section to address current concerns relating to attached units, and other changes to its standards. Unified Development Ordinance Amendment - Drive-Thru Queueing Amend the Unified Development Ordinance to update the requirements for drive-thru uses to reflect changes in demand and pick-up delivery methods. Unified Development Ordinance Amendment -Mixed Use Zoning District Revisions to the Mixed-Use zoning district are needed to better implement the Urban Center and Neighborhood Center land use categories. These amendments are anticipated to begin following the adoption of the Northeast Gateway Redevelopment Plan. Unified Development Ordinance Amendment -Planned Development District Amendments to the planned development district to set certain standards for its use and applicability. Unified Development Ordinance Amendment - Townhouse Parking Ordinance amendment to revise off-street parking and related requirements associated with Townhouse uses so that they are consistent in the various zoning districts in which the use is allowed and alleviate issues with continuous driveways along streets and obstruction to sidewalks. Unified Development Ordinance Amendment -Traffic Impact Analysis Ordinance amendment to update traffic impact analysis requirements that consider changes drafted by the MPO and other modifications such as applicability thresholds, varying scopes, safety implications, bicycle and pedestrian users, and site-related elements. Walkability and Bikeability Audit Program Establish a program for walkability and bikeability audits. Wellborn District Plan Implementation Implementation of actions identified within the Wellborn District Plan. The plan is slated for adoption in October 2023 and the actions to be implemented first will be identified after plan adoption. Page 194 of 206 September 18, 2023 Item No. 3.5. Tactical Urbanism Sponsor: Carl Ahrens, Staff Planner Reviewed By CBC: N/A Agenda Caption: Presentation, discussion, and possible action regarding the development of a potential tactical urbanism program. Relationship to Strategic Goals: • Improving Mobility • Neighborhood Integrity Recommendation(s): Staff recommends the Board receive the presentation and provide feedback. Summary: The Board requested a future agenda item regarding tactical urbanism at the April 2023 meeting. This item will provide some background on the topic, and how other cities have implemented and managed projects brought forth by the public. Tactical urbanism is an approach to neighborhood building and activation using short-term, low-cost, scalable interventions and policies aiming to change the overall use and feel of streets and public spaces. While temporary in nature, tactical urbanism practices can be used as a pilot program to identify potential projects to implement long- term change. The goal is to test new designs and ideas that will improve the safety, health, and vitality of neighborhood and community areas. Generally, it is citizen-led though it can also be initiated by governmental entities. This presentation will focus on what the City’s involvement could be, as well as introduce what other jurisdictions have done from a local government’s perspective. The guide and permitting process for Fayetteville, Arkansas is attached as an example. Other jurisdictions and sample project types will be provided in the presentation. The purpose of this item is to receive initial feedback from the Board. If the Board recommends that aspects should be explored further, staff will pursue developing a tactical urbanism program as determined in consultation with other City departments, Boards, and City Council direction Budget & Financial Summary: Attachments: 1. Tactical Urbanism Guide - Fayetteville Arkansas Page 195 of 206 A GUIDE TO COMMUNITY-LED P LACEMAK ING P ROJECTS Permitting Process, Application, & Materials Guide “AN APPROACH TO NEIGHBORHOOD BUILDING USING SHORT-TERM, LOW-COST, AND SCALABLE INTERVENTIONS TO CATALYZE LONG-TERM CHANGE.”1 TACTICAL URBANISM PHOTO CREDIT: FAYETTEVILLE FLYER Page 196 of 206 TABLE OF CONTENTS BACKGROUND............................................... 3 THE APPLICATION PROCESS (PAGES 4-6) TIMELINE .......................................................... 4 GUIDELINES ................................................. 5-6 INSTALLATION (PAGES 7-11) SIGNAGE & SAFETY ....................................... 7 INSTALLATION DAY PERMITS ......................... 8 EVALUATION & METRICS ............................... 9 MATERIALS GUIDE ........................................ 10 APPROVAL SIGN .......................................... 11 FOR MORE INFORMATION VISIT: FAYETTEVILLE-AR.GOV/TACTICALURBANISM FOR ASSISTANCE, CONTACT THE ENGINEERING DIVISION: ENGINEERING@FAYETTEVILLE-AR.GOV 479.575.8206 2 Page 197 of 206 What is Tactical Urbanism? BACKGROUND Tactical Urbanism is a set of techniques that cities or community groups can use to test out low- cost, short-term improvements to the built environment.1 The goal of Tactical Urbanism is to test new designs and ideas that will improve the safety, health, and happiness of our neighborhoods. 3 What is the built environment? The built environment is any of the human-made aspects of our world - streets, parks, homes, offices, etc. The built environment has significant impact on our daily lives. We are affected by the presence (or absence) of sidewalks and bike lanes, the width of streets, and the number of trees lining the road. Health,2 happiness,3 and safety4 depend, in large part, on the physical world around us. Public safety, public health, and overall quality-of-life are improved when the built environment reflects the values, character, and history of our community.5 How can Tactical Urbanism improve our built environment? In order to encourage and enable residents to participate in improving the built environment, the City has developed a community-led Tactical Urbanism permit application. By working with City staff, using Tactical Urbanism techniques, and gathering information on a project’s success- es and failures, residents can take an active role in improving the built environment in their own neighborhoods. Successful Tactical Urbanism projects are happening all across the globe. These projects come in all shapes and sizes. Past installations included transforming intersections into pedestrian plazas,6 creating pop-up parks in parking spaces,7 and installing crowd-sourced signage to key commu- nity destinations.8 Right here in Northwest Arkansas, bike lanes and pedestrian infrastructure were installed temporarily using Tactical Urbanism techniques.9 You can read about other exemplary projects at the Street Plans Collaborative website.10 Page 198 of 206 Up to two months prior to desired installation date: - Read the City’s Tactical Urbanism Guide. - Define the scope, purpose, and intended results of your project. - Meet with neighbors, design your site plan, collect pre-installation data, and make initial materials list. Between 10 and 55 days prior to desired installation date: - Fill out your permit application. Make sure to include full project description, timeline, and any required supporting materials. - Submit your application. Step 1 Step 2 Step 3 If approved, you may still need to apply for: A Street-Closure Permit allows for detour routes and street and lane closures. Up to 5 days to approve. An Event Permit allows for block parties, noise variances, parades, or other large events. Up to 45 days to approve. Within 10 days of application submittal: - You will receive an email from the Engineering Division with one of the following responses: ApprovedYou may install your project as submitted in your application. Congratulations!Not ApprovedIf more information or changes are needed, your application will be returned, with comments included. When you have addressed the comments, you may re- submit your application. Event Permit StreetClosure 4 THE APPLICATION PROCESS Timeline Before submitting your application, use this timeline to help you determine how long the approval process may take. Approval can take between 10 and 55 days, based on the scope of your project and the permits you may be required to apply for. Page 199 of 206 5 Guidelines for a successful application To help citizens design the best possible projects, City staff has put together the following guidelines for community-led Tactical Urbanism. By following these guidelines, your project will have the best possible chance of approval. These guidelines were collected from existing codes, ordinances, and laws on the national, state, and city level. Do your best to pick a site that avoids the following: 1. State Highways. The Arkansas Highway and Transportation Department (AHTD) will not approve citizen-led project within an AHTD right of way. All projects must avoid state highways. 2. Streets classified as arterial or collector. You can use the city’s color-coded map to help you identify what streets are arterial or collectors. These streets have high volumes of traffic and high speeds, making them difficult for citizen-led projects. 3. Streets with speed-limits of more than 25 miles per hour. These streets may be deemed too dangerous for citizen-led projects. 4. Stops for delivery trucks, public transit, or trash and recycling collection. If you choose a location where you will interfere with these services, you are required to contact the affected parties and receive written confirmation that they are aware of and approve of your proj- ect. You can upload any correspondence in the “Additional Documentation” section of the application. You are not required to contact these services if you will only temporarily impede access during the day of installation or removal. 5. Public utilities, utility covers, valves, etc. If you prevent access to public utility access points, City staff are not likely to approve your design. These features must be accessible. 6. Blocking driveways. If you will be designing a project that blocks a driveway, please upload signed letters of approval from occupants in the “Additional Documentation” section of the application. THE APPLICATION PROCESS Page 200 of 206 Emergency Vehicle Access Additionally, the diagram to the right shows necessary clearance for a fire hydrant, which is 26 feet. If your design prevents this level of access, it is unlikely that your project will be approved, unless the materials that you choose are easily mountable. MUTCD and ADA Compliance Neighborhood Involvement We highly recommend that you involve your neighbors in the planning, design, and construction process. While the City does not mandate that you inform your neighbors, doing so will improve the chances that your project will be successfully received. In addition to involving neighbors in the planning process, we encourage you to actively en- gage individuals who may come in contact with your project. You might put out a homemade comment box or have a message board where visitors can record their reactions. Tactical Urbanism is about building community through safe and happy neighborhoods; involving neigh- bors is a vital component of the process. We highly encourage applicants to familiarize themselves with the rules for street markings and street designs. The Manual on Uniform Traffic Control Devices (MUTCD) and the Americans With Disabilities Act (ADA) both contain important information about safety, accessibility, and design standards. These standards are periodically updated. Please consider the current MUTCD and ADA street guidelines before submitting your application. You may want to contact the City’s ADA Administrator or Engineering Division for guidance: engineering@fayetteville-ar.gov or 479.575.8206 HYDRANT6 Guidelines for a successful application In addition to the items previously listed, please keep the following items in mind when plan- ning your design: In order for emergency vehicles to maneuver safely, 20 feet of horizontal roadway clearance is required. Your project may not be approved if it reduces the street width to less than 20 feet, unless materials are mountable (able to be driven over by a vehicle without any damage to the vehicle). THE APPLICATION PROCESS Page 201 of 206 INSTALLATION Installation Day : Signage and Safety Consider creating a social media page for your installation day. You can invite neighbors, link to a crowd-funding site for material costs, collect feedback in real-time, or share your project across the globe. Once you have submitted and received an approval from City staff, it is time to plan installation day! We encourage you to reach out to neighbors to alert them to the project and invite them to participate. Tactical Urbanism works best when community-led and we encourage you to engage neighbors and friends as much as possible in each step of the process. 7 For installation day, please fill out and print at least one copy of the Approved Project sign at the end of this guide. This sign should be posted in a prominent location near your installation site. The sign will allow anyone who encounters your project to see that it has been approved by the City and will also provide them with a link to a survey feedback form. Required Signage at your installation You can fill out the blank box at the center of the sign with details about the project design, ma- terials, and participants. Be as creative as you like! This sign must be present at your installation site for the entire duration of the project, not only in- stallation day. We recommend laminating the sign to help it resist the elements and posting one or more signs near the project. Make SAFETY your number one priority! We highly suggest using dedicated safety equipment during your installation and removal events. We recommend designating a “safety captain” who can ensure that traffic is safely and efficiently directed away from any project participants. Traffic vests, cones, and Stop or Yield signs will improve visibility, slow vehicles, and increase the safety of your installation. Homemade signs or barriers are appropriate for slowing traffic during installation day. Page 202 of 206 8 INSTALLATION Additional Installation Day Permits After you have received an approval from City Staff, you may be directed to fill out an addition- al permit application specifically for your installation or removal day. City staff will indicate if one of these additional forms is necessary. Do not fill out an additional permit if staff do not indicate a need for it. You may be asked for the following: Street Closure Permit Event Permit Even if your project does not meet the conditions for an Event Permit but you still plan to tempo- rarily close a road, you may be required to fill out a Street Closure Application for your installation day. This permit is necessary if: 1. You will be creating a detour route due to a closed local, residential, or low volume street. 2. You will be closing lanes or streets designated as collector streets or higher, or that have higher volumes of traffic. This permit must be submitted no later than five business days prior to date of closure. Street designations can be found on the Master Street Plan map. It is not necessary to fill out this application for lane closures on local or residential low-volume streets where you use will flaggers to maintain two-way traffic. Event Permits are required for large events such as festivals, block parties, parades, etc. Event Permit Applications are required for any event that takes place on City property and requires City resources (police assistance, noise ordinance variance request, etc.). If your Tactical Urban- ism installation or removal day involves these components, you may be required to fill out an Event Permit. If you will be closing a street or parking lot for less than eight hours, you will be required to submit your application 21 days prior to the event date. If you will be closing a street or parking lot for more than eight hours, you will be required to submit an Event Permit application 45 days prior to your event date. You will also be required to gather signatures of approval from all residents, occupants, and business owners in a 300 foot ra- dius of your event. We highly suggest restricting your installation day activities to less than 8 hours. Page 203 of 206 Develop Collect EvaluateStrategize Share Second, complete pre-installation data collection. You might want to do pedestrian or cyclist counts at a street crossing or attendence counts at an outdoor venue. You might ask local businesses if they are willing to fill out a simple retail performance form, or you might create a survey to measure citi- zen satisfaction with the status-quo situation. Third, capture impressions and feedback during the time that your project is installed. You might repeat your cyclist/pedestrian counts, put up a comment box to collect feedback, create a QR code with a link to an online survey, or put up an on-site message board. Think about how your feedback mechanisms can be both a tool for data collection and a way for community mem- bers to engage with the built environment. Finally, if you are interested in sharing this data with the City, contact the engineering depart- ment to set up a post-project discussion. You should be prepared to present a report about the project and its successes. You can also contact the engineering department if you would like to access the City survey feedback on your installation. City staff will consider youu project report, public feedback, and budgetary considerations to determine the long term viability of your project. INSTALLATION Evaluation & Metrics If the intent of your project is to demonstrate a change that could be permanent in the long term, we highly encourage you to build evaluation tools and measurements into your planning process. First, develop an evaluation strategy for your project. Do you want to demonstrate increased pedestrian use of an area because of your traffic calming measures? Do you hope to show an increase in sales or attendance? Do you need quantitative or qualitative data? How might you best collect this information? Think about your goals and how you might measure the success of your project in achieving those goals. The City has a dedicated survey form set up to receive feedback on citizen-led Tactical Urbanism projects. You can access this survey at: http://www.surveymonkey.com/r/fayettevilletacticalurbanism or by calling the Engineering Department 9 Page 204 of 206 INSTALLATION 10 REFERENCES: 1. Street Plans Collaborative: “Community-Led Demonstration Project Policy Guide” (April 2016). 2. Center for Disease Control and Prevention: “Healthy Places” (2017). 3. Benfield, Kaid: “Why the Places We Live Make Us Happy” (2012). 4. National Crime Prevention Council: “Crime Prevention Through Environmental Design,” (2017). 5. Dannenberg, Andrew; Howard Frumkin; and Richard J. Jackson: “Making Healthy Places: Designing and Building for Health, Well-Being, and Sustainability,” Island Press, (2011). 6. NYC Department of Transportation “Plaza Program” The City of New York (2017). 7. Park(ing) Day Global Annual Event - http://parkingday.org/ 8. Walk Your City - http://walkyourcity.org/ 9. Street Plans Collaborative: “Bike NWA Final Report” (December 2016). 10. Street Plans Collaborative: ‘Tactical Urbanism Projects” (2017). Materials Guide: We highly suggest researching past Tactical Urbanism projects when selecting materials for your project. You will want to consider the longevity, impending weather, and goals of your project before selecting materials. Keep in mind - you are responsible for the placement and removal of all materials used for your project (this includes paint on streets or sidewalks). City staff will not remove your project, so do not use materials that will require heavy duty machinery to remove. The emergency contact that you note on your project application will be held responsible for final removal after the project has ended. Material Suggestions: • Duct tape • Spray chalk • Straw bales • Traffic cones • Traffic tape • Potted plants • Wood pallets • Hand-painted signs • Reflective glass beads for street markings • Chalk line reel for making straight lines • Cardboard stencils for art or directional signs • Found objects and recycled materials make great components of Tactical Urbanism projects The City is excited to see how resourceful, artistic, andinnovative Fayetteville citizens can be! Please contact the City’s Engineering Division with any questions: 479.575.8206. More information is available online at fayetteville-ar.gov/tacticalurbanism Page 205 of 206 WANT TO CREATE YOUR OWN TACTICAL URBANISM PROJECT? WW W.FAYETTEVILLE-AR.GOV/TACTICALURBANISM THIS IS A CITY OF FAYETTEVILLE APPROVED TACTICAL URBANISM PROJECT This project includes: Tactical Urbanism is a set of techniques that cities or community groups can use to test out low-cost, short-term improvements to the built environment. The goal of Tactical Urbanism is to test new designs and ideas that will improve the safety, health, happiness, and community connectivity of our neighborhoods. You can offer feedback on this project at www.surveymonkey.com/r/FayettevilleTacticalUrbanism Page 206 of 206